Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit ACCN3 Polyclonal Antibody | anti-ASIC3 antibody

ACCN3 antibody - N-terminal region

Gene Names
ASIC3; ACCN3; TNaC1; DRASIC; SLNAC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ACCN3; Polyclonal Antibody; ACCN3 antibody - N-terminal region; anti-ASIC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
Sequence Length
531
Applicable Applications for anti-ASIC3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 100%; Mouse: 87%; Pig: 87%; Rabbit: 87%; Rat: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(Host: RabbitTarget Name: ACCN3Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACCN3Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ACCN3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Human Kidney)

Western Blot (WB) (WB Suggested Anti-ACCN3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Human Kidney)
Related Product Information for anti-ASIC3 antibody
This is a rabbit polyclonal antibody against ACCN3. It was validated on Western Blot and immunohistochemistry

Target Description: ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
Product Categories/Family for anti-ASIC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
acid-sensing ion channel 3 isoform a
NCBI Official Synonym Full Names
acid sensing ion channel subunit 3
NCBI Official Symbol
ASIC3
NCBI Official Synonym Symbols
ACCN3; TNaC1; DRASIC; SLNAC1
NCBI Protein Information
acid-sensing ion channel 3
UniProt Protein Name
Acid-sensing ion channel 3
Protein Family
UniProt Gene Name
ASIC3
UniProt Synonym Gene Names
ACCN3; SLNAC1; TNAC1; ASIC3; hASIC3; hTNaC1
UniProt Entry Name
ASIC3_HUMAN

NCBI Description

This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 2 has been observed as proton-gated channels sensitive to gadolinium. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]

Uniprot Description

ASIC3: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Generates a biphasic current with a fast inactivating and a slow sustained phase. In sensory neurons is proposed to mediate the pain induced by acidosis that occurs in ischemic, damaged or inflamed tissue. May be involved in hyperalgesia. May play a role in mechanoreception. Heteromeric channel assembly seems to modulate channel properties. Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ASIC3 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Membrane protein, integral; Channel, cation; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q35

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: amiloride-sensitive sodium channel activity; enterobactin transporter activity; cation channel activity; sodium channel activity; PDZ domain binding

Biological Process: detection of mechanical stimulus involved in sensory perception of pain; detection of chemical stimulus involved in sensory perception of pain; transport; response to heat; sensory perception; sensory perception of sour taste; enterobactin transport; response to acidity; detection of temperature stimulus involved in sensory perception of pain; signal transduction; transmembrane transport

Research Articles on ASIC3

Similar Products

Product Notes

The ASIC3 asic3 (Catalog #AAA3202449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACCN3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACCN3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ASIC3 asic3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VATFLYQVAE RVRYYREFHH QTALDERESH RLIFPAVTLC NINPLRRSRL. It is sometimes possible for the material contained within the vial of "ACCN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.