Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ABLIM3 expression in transfected 293T cell line by ABLIM3 polyclonal antibody. Lane 1: ABLIM3 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ABLIM3 Polyclonal Antibody | anti-ABLIM3 antibody

ABLIM3 (Actin-binding LIM Protein 3, abLIM-3, Actin-binding LIM Protein Family Member 3, KIAA0843, HMFN1661)

Gene Names
ABLIM3; HMFN1661
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ABLIM3; Polyclonal Antibody; ABLIM3 (Actin-binding LIM Protein 3; abLIM-3; Actin-binding LIM Protein Family Member 3; KIAA0843; HMFN1661); Anti -ABLIM3 (Actin-binding LIM Protein 3; anti-ABLIM3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ABLIM3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEGNFWKSGCL
Applicable Applications for anti-ABLIM3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ABLIM3, aa1-544 (AAH01665.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ABLIM3 expression in transfected 293T cell line by ABLIM3 polyclonal antibody. Lane 1: ABLIM3 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ABLIM3 expression in transfected 293T cell line by ABLIM3 polyclonal antibody. Lane 1: ABLIM3 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ABLIM3 antibody
May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.
Product Categories/Family for anti-ABLIM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,802 Da
NCBI Official Full Name
actin-binding LIM protein 3
NCBI Official Synonym Full Names
actin binding LIM protein family, member 3
NCBI Official Symbol
ABLIM3
NCBI Official Synonym Symbols
HMFN1661
NCBI Protein Information
actin-binding LIM protein 3; abLIM-3; actin-binding LIM protein family member 3
UniProt Protein Name
Actin-binding LIM protein 3
Protein Family
UniProt Gene Name
ABLIM3
UniProt Synonym Gene Names
KIAA0843; abLIM-3
UniProt Entry Name
ABLM3_HUMAN

NCBI Description

The LIM domain is a double zinc finger structure that promotes protein-protein interactions. LIM domain proteins, such as ABLIM3, play roles in embryonic development, cell lineage determination, and cancer (Krupp et al., 2006 [PubMed 16328021]).[supplied by OMIM, Mar 2008]

Uniprot Description

ABLIM3: May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: lamellipodium; cytoplasm; stress fiber

Molecular Function: zinc ion binding; actin binding

Biological Process: lamellipodium biogenesis; axon guidance; transcription, DNA-dependent; cilium biogenesis; positive regulation of transcription from RNA polymerase II promoter; actin cytoskeleton organization and biogenesis

Research Articles on ABLIM3

Similar Products

Product Notes

The ABLIM3 ablim3 (Catalog #AAA643525) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABLIM3 (Actin-binding LIM Protein 3, abLIM-3, Actin-binding LIM Protein Family Member 3, KIAA0843, HMFN1661) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABLIM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ABLIM3 ablim3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNTSIPYQQN PYNPRGSSNV IQCYRCGDTC KGEVVRVHNN HFHIRCFTCQ VCGCGLAQSG FFFKNQEYIC TQDYQQLYGT RCDSCRDFIT GEVISALGRT YHPKCFVCSL CRKPFPIGDK VTFSGKECVC QTCSQSMASS KPIKIRGPSH CAGCKEEIKH GQSLLALDKQ WHVSCFKCQT CSVILTGEYI SKDGVPYCES DYHAQFGIKC ETCDRYISGR VLEAGGKHYH PTCARCVRCH QMFTEGEEMY LTGSEVWHPI CKQAARAEKK LKHRRTSETS ISPPGSSIGS PNRVICDIYE NLDLRQRRAS SPGYIDSPTY SRQGMSPTFS RSPHHYYRSG DLSTATKSKT SEDISQTSKY SPIYSPDPYY ASESEYWTYH GSPKVPRARR FSSGGEEDDF DRSMHKLQSG IGRLILKEEM KARSSSYADP WTPPRSSTSS REALHTAGYE MSLNGSPRSH YLADSDPLIS KSASLPAYRR NGLHRTPSAD LFHYDSMNAV NWGMREYKIY PYELLLVTTR GRNRLPKDVD RTRLEGNFWK SGCL. It is sometimes possible for the material contained within the vial of "ABLIM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.