Rabbit anti-Human, Mouse ABI2 Polyclonal Antibody | anti-ABI2 antibody
ABI2 Polyclonal Antibody
Gene Names
ABI2; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ABI2; Polyclonal Antibody; ABI2 Polyclonal Antibody; ABI-2; ABI2B; AblBP3; AIP-1; argBP1; argBPIA; argBPIB; SSH3BP2; anti-ABI2 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT
Sequence Length
513
Applicable Applications for anti-ABI2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human ABI2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell projection, Cytoplasm, cytoskeleton, filopodium, lamellipodium
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-ABI2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44kDa/52kDa/54kDa/55kDa
NCBI Official Full Name
abl interactor 2 isoform a
NCBI Official Synonym Full Names
abl interactor 2
NCBI Official Symbol
ABI2
NCBI Official Synonym Symbols
ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB
NCBI Protein Information
abl interactor 2
UniProt Protein Name
Abl interactor 2
Protein Family
UniProt Gene Name
ABI2
UniProt Synonym Gene Names
ARGBPIA; Abi-2; AblBP3; ArgBP1
Uniprot Description
May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes ().
Research Articles on ABI2
Similar Products
Product Notes
The ABI2 abi2 (Catalog #AAA9134982) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABI2 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ABI2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ABI2 abi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKEKVARREI GILTTNKNTS RTHKIIAPAN LERPVRYIRK PIDYTILDDI GHGVKWLLRF KVSTQNMKMG GLPRTTPPTQ KPPSPPMSGK GTLGRHSPYR T. It is sometimes possible for the material contained within the vial of "ABI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
