Mouse anti-Human ABCC6 Polyclonal Antibody | anti-ABCC6 antibody

ABCC6 (Multidrug Resistance-associated Protein 6, ATP-binding Cassette Sub-family C Member 6, Anthracycline Resistance-associated Protein, Multi-specific Organic Anion Transporter E, MOAT-E, ARA, MRP6)

Cat. Num. AAA6000396

• Gene Names: ABCC6; ARA; PXE; MLP1; MRP6; PXE1; URG7; ABC34; GACI2; MOATE; MOAT-E; EST349056
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ABCC6; Polyclonal Antibody; ABCC6 (Multidrug Resistance-associated Protein 6; ATP-binding Cassette Sub-family C Member 6; Anthracycline Resistance-associated Protein; Multi-specific Organic Anion Transporter E; MOAT-E; ARA; MRP6); Anti -ABCC6 (Multidrug Resistance-associated Protein 6; anti-ABCC6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ABCC6.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVRGRQGTGWNLVKS

• Applicable Applications for anti-ABCC6 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ABCC6, aa1-99 (NP_001072996.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ABCC6 expression in transfected 293T cell line by ABCC6 polyclonal antibody. Lane 1: ABCC6 transfected lysate (10.89kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ABCC6 antibody

May participate directly in the active transport of drugs into subcellular organelles or influence drug distribution indirectly. Transports glutathione conjugates as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS).

Product Categories/Family for anti-ABCC6 antibody

Antibodies; Abs to Multi Drug Resistance (MDR)

NCBI and Uniprot Product Information

• NCBI GI #: 160332573
• NCBI GeneID: 368
• UniProt Accession #: A8Y988; O95255
• Molecular Weight: 164,829 Da
• NCBI Official Full Name: ATP-binding cassette (sub-family C, member 6)
• NCBI Official Synonym Full Names: ATP-binding cassette, sub-family C (CFTR/MRP), member 6
• NCBI Official Symbol: ABCC6
• NCBI Official Synonym Symbols: ARA; PXE; MLP1; MRP6; PXE1; URG7; ABC34; GACI2; MOATE; MOAT-E; EST349056
• NCBI Protein Information: URG7 protein; multidrug resistance-associated protein 6; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein
• UniProt Protein Name: ATP-binding cassette (Sub-family C, member 6)
• Protein Family: ABC transporter C family
• UniProt Gene Name: ABCC6
• UniProt Entry Name: A8Y988_HUMAN

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCC6: May participate directly in the active transport of drugs into subcellular organelles or influence drug distribution indirectly. Transports glutathione conjugates as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS). Defects in ABCC6 are the cause of pseudoxanthoma elasticum (PXE). PXE is a disorder characterized by calcification of elastic fibers in skin, arteries and retina that results in dermal lesions with associated laxity and loss of elasticity, arterial insufficiency and retinal hemorrhages leading to macular degeneration. PXE is caused in the overwhelming majority of cases by homozygous or compound heterozygous mutations in the ABCC6 gene (autosomal recessive PXE). Individuals carrying heterozygous mutations express limited manifestations of the pseudoxanthoma elasticum phenotype (autosomal dominant PXE). Defects in ABCC6 are the cause of arterial calcification of infancy, generalized, type 2 (GACI2). GACI2 is a severe autosomal recessive disorder characterized by calcification of the internal elastic lamina of muscular arteries and stenosis due to myointimal proliferation. The disorder is often fatal within the first 6 months of life because of myocardial ischemia resulting in refractory heart failure. Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, ABC family; Hydrolase

Chromosomal Location of Human Ortholog: 16p13.1

Cellular Component: endoplasmic reticulum membrane; basolateral plasma membrane; apical plasma membrane; plasma membrane; integral to membrane; nucleus; lateral plasma membrane

Molecular Function: transporter activity; ATPase activity, coupled to transmembrane movement of substances; ATP binding

Biological Process: response to drug; visual perception; metabolic process; transport; transmembrane transport

Disease: Arterial Calcification, Generalized, Of Infancy, 2; Pseudoxanthoma Elasticum, Forme Fruste; Pseudoxanthoma Elasticum