Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Abcb8 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Muscle)

Rabbit Abcb8 Polyclonal Antibody | anti-ABCB8 antibody

Abcb8 Antibody - middle region

Gene Names
Abcb8; AA409895; 4833412N02Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Abcb8; Polyclonal Antibody; Abcb8 Antibody - middle region; anti-ABCB8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN
Sequence Length
717
Applicable Applications for anti-ABCB8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Abcb8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Abcb8 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Muscle)

Western Blot (WB) (WB Suggested Anti-Abcb8 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Muscle)
Related Product Information for anti-ABCB8 antibody
This is a rabbit polyclonal antibody against Abcb8. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ABCB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
ATP-binding cassette sub-family B member 8, mitochondrial
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family B (MDR/TAP), member 8
NCBI Official Symbol
Abcb8
NCBI Official Synonym Symbols
AA409895; 4833412N02Rik
NCBI Protein Information
ATP-binding cassette sub-family B member 8, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 8, mitochondrial
UniProt Gene Name
Abcb8
UniProt Entry Name
ABCB8_MOUSE

Uniprot Description

ABCB8: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, it may involve the compartmentalization and transport of heme, as well as peptides, from the mitochondria to the nucleus and cytosol. This protein may also play a role in the transport of phospholipids into mitochondrial membranes. [provided by RefSeq, Jul 2008]

Protein type: Transporter, ABC family; Hydrolase; Membrane protein, multi-pass; Membrane protein, integral; Transporter; Mitochondrial

Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; integral to membrane; nucleolus; nucleus

Molecular Function: ATPase activity, coupled to transmembrane movement of substances; ATPase activity; nucleotide binding; ATP binding

Biological Process: transport; transmembrane transport

Research Articles on ABCB8

Similar Products

Product Notes

The ABCB8 abcb8 (Catalog #AAA3206986) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Abcb8 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Abcb8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABCB8 abcb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADEALGNVRT VRAFAMEKRE EERYQAELES CCCKAEELGR GIALFQGLSN. It is sometimes possible for the material contained within the vial of "Abcb8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.