Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AASDH expression in transfected 293T cell line by AASDH polyclonal antibody. Lane 1: AASDH transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human AASDH Polyclonal Antibody | anti-AASDH antibody

AASDH (Acyl-CoA Synthetase Family Member 4, Aminoadipate-semialdehyde Dehydrogenase, Protein NRPS998, ACSF4, U26, HSPC318)

Gene Names
AASDH; LYS2; ACSF4; NRPS998; NRPS1098
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AASDH; Polyclonal Antibody; AASDH (Acyl-CoA Synthetase Family Member 4; Aminoadipate-semialdehyde Dehydrogenase; Protein NRPS998; ACSF4; U26; HSPC318); Anti -AASDH (Acyl-CoA Synthetase Family Member 4; anti-AASDH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AASDH.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN
Applicable Applications for anti-AASDH antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human AASDH, aa1-134 (AAH15096).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AASDH expression in transfected 293T cell line by AASDH polyclonal antibody. Lane 1: AASDH transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AASDH expression in transfected 293T cell line by AASDH polyclonal antibody. Lane 1: AASDH transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AASDH antibody
Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.
Product Categories/Family for anti-AASDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
122,597 Da
NCBI Official Full Name
AASDH protein
NCBI Official Synonym Full Names
aminoadipate-semialdehyde dehydrogenase
NCBI Official Symbol
AASDH
NCBI Official Synonym Symbols
LYS2; ACSF4; NRPS998; NRPS1098
NCBI Protein Information
acyl-CoA synthetase family member 4; non-ribosomal peptide synthetase 998; non-ribosomal peptide synthetase 1098; 2-aminoadipic 6-semialdehyde dehydrogenase
UniProt Protein Name
Acyl-CoA synthetase family member 4
UniProt Gene Name
AASDH
UniProt Synonym Gene Names
ACSF4; U26
UniProt Entry Name
ACSF4_HUMAN

Uniprot Description

AASDH: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Belongs to the ATP-dependent AMP-binding enzyme family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - lysine biosynthesis; Oxidoreductase; Ligase; Amino Acid Metabolism - lysine degradation; EC 1.2.1.31

Chromosomal Location of Human Ortholog: 4q12

Molecular Function: acid-thiol ligase activity; ATP binding

Biological Process: fatty acid metabolic process

Research Articles on AASDH

Similar Products

Product Notes

The AASDH aasdh (Catalog #AAA6007208) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AASDH (Acyl-CoA Synthetase Family Member 4, Aminoadipate-semialdehyde Dehydrogenase, Protein NRPS998, ACSF4, U26, HSPC318) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AASDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the AASDH aasdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTLQELVHKA ASCYMDRVAV CFDECNNQLP VYYTYKTVVN AASELSNFLL LHCDFQGIRE IGLYCQPGID LPSWILGILQ VPAAYVPIEP DSPPSLSTHF MKKCNLKYIL VEKKQINVSL DVSIVFCLYY IYFN. It is sometimes possible for the material contained within the vial of "AASDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.