Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24073'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.11 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24073' and pd.language_id = 1
Query
Database
1.34 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24073'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.02 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24073'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24073' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24073'
⇄specificity => string (22) "Recognizes human PEPD."
$value['specificity']
⇄purity => string (67) "Affinity Purified<br>Purified by Protein A affinity chromatography."
$value['purity']
⇄form => string (36) "Supplied as a liquid in PBS, pH 7.2."
$value['form']
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (270) "May be stored at 4 degree C for short-term only. Aliquot to avoid repeated f...
$value['storage_stability']
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄⧉app_tested => string (84) "ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluoresce...
$value['app_tested']
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF)
⇄⧉app_notes => string (125) "Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecip...
$value['app_notes']
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation.<br>Dilution: Immunofluorescence: 10ug/ml
⇄⧉testing_protocols => string (904) "Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/...
$value['testing_protocols']
Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/ml as a capture antibody.||AAA24073_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of PEPD transfected lysate using PEPD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PEPD rabbit polyclonal antibody.||AAA24073_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to PEPD on HepG2 cell. [antibody concentration 10ug/ml]||AAA24073_IF4.jpg!!WB (Western Blot)||Western Blot analysis of PEPD expression in transfected 293T cell line by PEPD monoclonal antibody.<br>Lane 1: PEPD transfected lysate (Predicted MW: 54.6kD).<br>Lane 2: Non-transfected lysate||AAA24073_WB3.jpg!!WB (Western Blot)||PEPD monoclonal antibody Western Blot analysis of PEPD expression in HepG2.||AAA24073_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (79.97kD).||AAA24073_WB.jpg
⇄⧉etc_term1 => string (133) "Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD ...
$value['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD (AAH15027) with GST tag. MW of the GST tag alone is 26kD.
⇄⧉products_description => string (181) "Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal p...
$value['products_description']
Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
⇄products_references => string (3) "N/A"
$value['products_references']
⇄products_related_diseases => string (3) "N/A"
$value['products_related_diseases']
⇄products_categories => string (37) "Antibodies; Abs to Enzymes; Peptidase"
⇄specificity => string (22) "Recognizes human PEPD."
$value->a['specificity']
⇄purity => string (67) "Affinity Purified<br>Purified by Protein A affinity chromatography."
$value->a['purity']
⇄form => string (36) "Supplied as a liquid in PBS, pH 7.2."
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (270) "May be stored at 4 degree C for short-term only. Aliquot to avoid repeated f...
$value->a['storage_stability']
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄⧉app_tested => string (84) "ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluoresce...
$value->a['app_tested']
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF)
⇄⧉app_notes => string (125) "Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecip...
$value->a['app_notes']
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation.<br>Dilution: Immunofluorescence: 10ug/ml
⇄⧉testing_protocols => string (904) "Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/...
$value->a['testing_protocols']
Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/ml as a capture antibody.||AAA24073_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of PEPD transfected lysate using PEPD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PEPD rabbit polyclonal antibody.||AAA24073_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to PEPD on HepG2 cell. [antibody concentration 10ug/ml]||AAA24073_IF4.jpg!!WB (Western Blot)||Western Blot analysis of PEPD expression in transfected 293T cell line by PEPD monoclonal antibody.<br>Lane 1: PEPD transfected lysate (Predicted MW: 54.6kD).<br>Lane 2: Non-transfected lysate||AAA24073_WB3.jpg!!WB (Western Blot)||PEPD monoclonal antibody Western Blot analysis of PEPD expression in HepG2.||AAA24073_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (79.97kD).||AAA24073_WB.jpg
⇄⧉etc_term1 => string (133) "Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD ...
$value->a['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD (AAH15027) with GST tag. MW of the GST tag alone is 26kD.
⇄⧉products_description => string (181) "Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal p...
$value->a['products_description']
Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄products_related_diseases => string (3) "N/A"
$value->a['products_related_diseases']
⇄products_categories => string (37) "Antibodies; Abs to Enzymes; Peptidase"
⇄specificity => string (22) "Recognizes human PEPD."
$value->d['specificity']
⇄purity => string (67) "Affinity Purified<br>Purified by Protein A affinity chromatography."
$value->d['purity']
⇄form => string (36) "Supplied as a liquid in PBS, pH 7.2."
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (270) "May be stored at 4 degree C for short-term only. Aliquot to avoid repeated f...
$value->d['storage_stability']
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄⧉app_tested => string (84) "ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluoresce...
$value->d['app_tested']
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF)
⇄⧉app_notes => string (125) "Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecip...
$value->d['app_notes']
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation.<br>Dilution: Immunofluorescence: 10ug/ml
⇄⧉testing_protocols => string (904) "Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/...
$value->d['testing_protocols']
Application Data||Detection limit for recombinant GST tagged PEPD is ~0.1ng/ml as a capture antibody.||AAA24073_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of PEPD transfected lysate using PEPD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PEPD rabbit polyclonal antibody.||AAA24073_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to PEPD on HepG2 cell. [antibody concentration 10ug/ml]||AAA24073_IF4.jpg!!WB (Western Blot)||Western Blot analysis of PEPD expression in transfected 293T cell line by PEPD monoclonal antibody.<br>Lane 1: PEPD transfected lysate (Predicted MW: 54.6kD).<br>Lane 2: Non-transfected lysate||AAA24073_WB3.jpg!!WB (Western Blot)||PEPD monoclonal antibody Western Blot analysis of PEPD expression in HepG2.||AAA24073_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (79.97kD).||AAA24073_WB.jpg
⇄⧉etc_term1 => string (133) "Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD ...
$value->d['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-494 from human PEPD (AAH15027) with GST tag. MW of the GST tag alone is 26kD.
⇄⧉products_description => string (181) "Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal p...
$value->d['products_description']
Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄products_related_diseases => string (3) "N/A"
$value->d['products_related_diseases']
⇄products_categories => string (37) "Antibodies; Abs to Enzymes; Peptidase"
$value->d['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->d['products_search_terms']
⇄ncbi_full_name => string (4) "PEPD"
$value->d['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value->d['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value->d['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value->d['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value->d['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value->d['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value->d['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value->d['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value->d['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value->d['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value->d['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value->d['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value->d['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value->d['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value->d['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value->d['sp_interactions']
⇄products_url => string (3) "N/A"
$value->d['products_url']
⇄products_viewed => string (1) "0"
$value->d['products_viewed']
⇄ncbi_summary_pdns => string (3) "N/A"
$value->d['ncbi_summary_pdns']
⇄sp_comments_pdns => string (3) "N/A"
$value->d['sp_comments_pdns']
⇄ncbi_research_articles_pdns => string (3) "N/A"
$value->d['ncbi_research_articles_pdns']
⇄products_description_extra => string (3) "N/A"
$value->d['products_description_extra']
⇄⧉public fields_below -> array (3)
$value->fields_below
⇄0 => string (31) "Related Product Information for"
⇄⧉testing_protocols => string (1572) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Bax antibo...
$value[0]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Bax antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30009_FCM8.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse skin tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemical analysis of paraffin-embedded mouse kidney tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse prostate tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human tonsil tissue using anti-Bax antibody. Counter stained with hematoxylin.||AAA30009_IHC2.jpg!!WB (Western Blot)||Western blot analysis of Bax on different lysates using anti-Bax antibody at 1/1, 000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: Human liver||AAA30009_WB.jpg
Apoptosis regulator BAX antibody; BAX antibody; Bax-protein antibody; BAX_HUMAN antibody; BAXA antibody; Baxdelta2G9 antibody; Baxdelta2G9omega antibody; Baxdelta2omega antibody; Bcl-2-like protein 4 antibody; BCL2 associated X protein antibody; BCL2 associated X protein omega antibody; BCL2 associated X protein transcript variant delta2 antibody; Bcl2-L-4 antibody; BCL2L4 antibody; membrane isoform alpha antibody
⇄products_gene_name => string (3) "BAX"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (708) "The Bcl-2 gene was isolated at the chromosomal breakpoint of t-bearing folli...
$value[0]['_source']['products_description']
The Bcl-2 gene was isolated at the chromosomal breakpoint of t-bearing follicular B cell lymphomas. Bcl-2 blocks cell death following a variety of stimuli and confers a death-sparing effect to certain hematopoietic cell lines following growth factor withdrawal. Bcl-2 is localized to outer mitochondrial membranes and endoplasmic reticulum as well as nuclear membranes. A related protein, designated Bax (Bcl-associated X protein), has extensive amino acid homology with Bcl-2 and both homodimerizes and forms heterodimers with Bcl-2. Overexpression of Bax accelerates apoptotic death induced by cytokine deprivation in an IL-3 dependent cell line and Bax also counters the death repressor activity of Bcl-2.
⇄⧉search_terms => string (1177) "aaa30009 rabbit human mouse rat monoclonal sz3 07 proa affinity purified 1*t...
$value[0]['_source']['search_terms']
aaa30009 rabbit human mouse rat monoclonal sz3 07 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunohistochemistry ihc immunoprecipitation ip flow cytometry fc facs 1:1000 5000 1:50 1:200 1:100 analysis of bax on different lysates using anti antibody at 000 dilution positive control lane hela 2 mcf 7 3 liver aaa30009_wb immunohistochemical paraffin embedded tonsil tissue counter stained with hematoxylin aaa30009_ihc2 cancer aaa30009_ihc3 breast carcinoma aaa30009_ihc4 prostate aaa30009_ihc5 kidney aaa30009_ihc6 skin aaa30009_ihc7 cytometric cells 50 red compared an unlabelled without incubation primary black alexa fluor 488 conjugated goat igg was used as the secondary aaa30009_fc8 apoptosis regulator protein bax_human baxa baxdelta2g9 baxdelta2g9omega baxdelta2omega bcl like 4 bcl2 associated x omega transcript variant delta2 l bcl2l4 membrane isoform alpha beta 21,184 da 4757838 np_004315.1 q07812 nm_004324.3 p55269 q07814 q07815 q8wz49 q9nr76 q9nyg7 q9ucz6 q9ucz7 q9uqd6 a8k4w1 600040 total ab type recombinant immunogen conjugation unconjugated sz307 ph7.41 bsa40 at000 hela2 mcf7 cells50 fluor488 like4
WB: 1:500-1:2000<br>IHC: 1:50-1:200<br>IF: 1:50-1:200<br>Customer Validation:<br>WB: Mouse, Rat, Human<br>IP: Human,Mouse
⇄⧉testing_protocols => string (1369) "IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using Bax...
$value[1]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using Bax Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28318_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Human colon using Bax Rabbit pAb at dilution of 1:50 (40x lens).||AAA28318_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Rat kidney using Bax Rabbit pAb at dilution of 1:50 (40x lens).||AAA28318_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Mouse kidney using Bax Rabbit pAb at dilution of 1:50 (40x lens).||AAA28318_IHC3.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Bax antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 30s.||AAA28318_WB2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Bax antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 5s.||AAA28318_WB.jpg
⇄⧉etc_term1 => string (232) "Immunogen||A synthetic peptide of human Bax!!Cellular Location||Cytoplasm, C...
$value[1]['_source']['etc_term1']
Immunogen||A synthetic peptide of human Bax!!Cellular Location||Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein!!Positive Samples||293T, HT-1080, Raji, HeLa, Mouse lung, Mouse testis, Rat testis, Rat ovary
⇄⧉products_description => string (775) "Background: The protein encoded by this gene belongs to the BCL2 protein fam...
$value[1]['_source']['products_description']
Background: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
⇄⧉testing_protocols => string (685) "IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using BAX...
$value[2]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using BAX antibody.||AAA29799_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cells using BAX antibody.||AAA29799_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using BAX antibody.||AAA29799_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using BAX antibody.||AAA29799_IF3.jpg!!WB (Western Blot)||Western blot analysis of extracts from normal (control) and BAX knockout (KO) 293T cells, using BAX antibody.||AAA29799_WB2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using BAX antibody.||AAA29799_WB.jpg
⇄etc_term1 => string (65) "Immunogen||Recombinant fusion protein of human BAX (NP_620116.1)."
⇄⧉products_description => string (763) "The protein encoded by this gene belongs to the BCL2 protein family. BCL2 fa...
$value[2]['_source']['products_description']
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (225) "Necrosis||1965!!Heart Diseases||1823!!Nervous System Diseases||1818!!Ischemi...
$value[2]['_source']['products_related_diseases']
Necrosis||1965!!Heart Diseases||1823!!Nervous System Diseases||1818!!Ischemia||1490!!Brain Diseases||1359!!Inflammation||983!!Breast Neoplasms||937!!Liver Diseases||932!!Intestinal Neoplasms||814!!Neoplasms, Experimental||749
⇄products_categories => string (16) "Total protein Ab"
⇄⧉search_terms => string (573) "aaa29799 rabbit human mouse rat polyclonal igg affinity purification pbs wit...
$value[2]['_source']['search_terms']
aaa29799 rabbit human mouse rat polyclonal igg affinity purification pbs with 50 glycerol ph7.4 western blot wb immunofluorescence if 1:500 1:1000 1:50 1:100 analysis of extracts various cell lines using bax antibody aaa29799_wb from normal control and knockout ko 293t cells aaa29799_wb2 c6 aaa29799_if3 nih 3t3 aaa29799_if4 u2os aaa29799_if5 hela aaa29799_if6 bcl2l4 apoptosis regulator isoform alpha bcl2 associated x 23kda bcl 2 like protein 4 l bax_human 20631958 np_620116.1 q07812 600040 total ab immunogen recombinant fusion conjugation unconjugated with50 protein4
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 2-8 degree C for one month. <br>Aliquot and store at -80 degree C for 12 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (57) "Positive Control; Immunogen; SDS-PAGE; Western Blot (WB)."
$value[3]['_source']['app_tested']
⇄app_notes => string (75) "(May be suitable for use in other assays to be determined by the end user.)"
⇄⧉search_terms => string (896) "aaa21110 e.coli homo sapiens human > 90 20mm tris 150mm nacl ph8.0 containin...
$value[3]['_source']['search_terms']
aaa21110 e.coli homo sapiens human > 90 20mm tris 150mm nacl ph8.0 containing 0.01 skl 5 trehalose positive control immunogen sds page western blot wb may be suitable for use in other assays to determined by the end user sequence information aaa21110_seq2 gene sequencing extract aaa21110_td2 aaa21110_sds3 recombinant protein bcl2 associated x bax apoptosis regulator isoform 1 bcl2l4 predicted molecular mass 22.7kda accurate 25kda as reducing conditions bcl 2 like 4 l 612149787 np_001278357.1 q07812 nm_001291428.1 q07814 p55269 q07815 q8wz49 q9nr76 q9nyg7 q9ucz6 q9ucz7 q9uqd6 a8k4w1 l22473 mrna signal transduction source prokaryotic expression residues met1~gln171 tags n terminal his tag subcellular location mitochondrion cytoplasm traits freeze dried powder isoelectric point 4.6 usage reconstitute ddh2o a concentration of 0 0.5 mg ml do not vortex >90 skl5 isoform1 like4 point4.6 of0
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[4]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (220) "Necrosis||2216!!Nervous System Diseases||2119!!Heart Diseases||2018!!Ischemi...
$value[4]['_source']['products_related_diseases']
Necrosis||2216!!Nervous System Diseases||2119!!Heart Diseases||2018!!Ischemia||1747!!Brain Diseases||1584!!Inflammation||1243!!Liver Diseases||1109!!Breast Neoplasms||1078!!Intestinal Neoplasms||916!!Liver Neoplasms||812
aaa23197 mouse recombinant and nature apoptosis regulator bax typical testing data standard curve for reference only aaa23197_sc elisa kit bcl2 associated x protein &ndash da bax_mouse 6680770 np_031553.1 q07813 nm_007527.3 assay type sandwich detection range 31.2 2000 pg ml sensitivity 15.6 intra cv <=6.6 inter <=9.7 recovery 104 recovery104
⇄⧉testing_protocols => string (1127) "IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse h...
$value[5]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse heart using BAX antibody.||AAA29801_IHC9.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse kidney using BAX antibody.||AAA29801_IHC8.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse liver using BAX antibody.||AAA29801_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human stomach using BAX antibody.||AAA29801_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human breast cancer using BAX antibody.||AAA29801_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using BAX antibody.||AAA29801_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat ovary using BAX antibody.||AAA29801_IHC3.jpg!!WB (Western Blot)||Western blot analysis of extracts from normal (control) and BAX knockout (KO) 293T cells, using BAX antibody.||AAA29801_WB2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using BAX antibody.||AAA29801_WB.jpg
⇄etc_term1 => string (58) "Immunogen||A synthetic peptide of human BAX (NP_620116.1)."
⇄⧉products_description => string (763) "The protein encoded by this gene belongs to the BCL2 protein family. BCL2 fa...
$value[5]['_source']['products_description']
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄⧉products_related_diseases => string (225) "Necrosis||1965!!Heart Diseases||1823!!Nervous System Diseases||1818!!Ischemi...
$value[5]['_source']['products_related_diseases']
Necrosis||1965!!Heart Diseases||1823!!Nervous System Diseases||1818!!Ischemia||1490!!Brain Diseases||1359!!Inflammation||983!!Breast Neoplasms||937!!Liver Diseases||932!!Intestinal Neoplasms||814!!Neoplasms, Experimental||749
⇄products_categories => string (16) "Total protein Ab"
⇄⧉search_terms => string (701) "aaa29801 rabbit human mouse rat polyclonal igg affinity purification pbs wit...
$value[5]['_source']['search_terms']
aaa29801 rabbit human mouse rat polyclonal igg affinity purification pbs with 50 glycerol ph7.4 western blot wb immunohistochemistry ihc immunoprecipitation ip 1:500 1:2000 1:100 1:200 1:50 analysis of extracts various cell lines using bax antibody aaa29801_wb from normal control and knockout ko 293t cells aaa29801_wb2 paraffin embedded ovary aaa29801_ihc3 lung cancer aaa29801_ihc4 breast aaa29801_ihc5 stomach aaa29801_ihc6 liver aaa29801_ihc7 kidney aaa29801_ihc8 heart aaa29801_ihc9 bcl2l4 apoptosis regulator isoform alpha bcl2 associated x 20kda bcl 2 like protein 4 l bax_human 20631958 np_620116.1 q07812 600040 total ab immunogen a synthetic peptide conjugation unconjugated with50 protein4
⇄⧉etc_term1 => string (140) "Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative...
$value[6]['_source']['etc_term1']
Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||0.78-50ng/mL!!Sensitivity||0.47ng/mL
⇄⧉etc_term2 => string (370) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Human BAX were tested 20 times on one plate, respectively.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Human BAX were tested on 3 different plates, 20 replicates in each plate.
⇄⧉products_description => string (1207) "Intended Uses: This ELISA kit applies to the in vitro quantitative determina...
$value[6]['_source']['products_description']
Intended Uses: This ELISA kit applies to the in vitro quantitative determination of Human BAX concentrations in serum, plasma and other biological fluids.<br><br>Principle of the Assay: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human BAX. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Human BAX and Avidin-Horseradish Peroxidase (HRP) conjugate are added successively to each micro plate well and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain Human BAX, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of stop solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The OD value is proportional to the concentration of Human BAX. You can calculate the concentration of Human BAX in the samples by comparing the OD of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[6]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[6]['_source']['products_categories']
⇄ncbi_full_name => string (3) "bax"
$value[6]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[6]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[6]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[6]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[6]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[6]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[6]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "30,603 Da"
$value[6]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[6]['_source']['ncbi_pathways']
⇄sp_protein_name => string (11) "Bax protein"
$value[6]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (11) "Bax protein"
$value[6]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "bax"
$value[6]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[6]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (12) "R4YID2_KLEPN"
$value[6]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[6]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[6]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[6]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[6]['_source']['products_viewed']
⇄⧉search_terms => string (557) "aaa21847 human this kit recognizes bax in samples no significant cross react...
$value[6]['_source']['search_terms']
aaa21847 human this kit recognizes bax in samples no significant cross reactivity or interference between and analogues was observed typical testing data standard curve for reference only aaa21847_td elisa bcl 2 associated x protein 30,603 da r4yid2_klepn 499532844 cci79209.1 serum plasma other biological fluids assay type quantitative sandwich detection range 0.78 50ng ml sensitivity 0.47ng intra precision within an 3 with low mid high level were tested 20 times on one plate respectively inter assays different plates replicates each bcl2 an3 tested20
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[7]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄⧉products_related_diseases => string (249) "Lymphoma, Non-Hodgkin||853!!Carcinoma||812!!Lymphoma, Large B-Cell, Diffuse|...
$value[7]['_source']['products_related_diseases']
Lymphoma, Non-Hodgkin||853!!Carcinoma||812!!Lymphoma, Large B-Cell, Diffuse||448!!Necrosis||431!!Lymphoma, Follicular||424!!Breast Neoplasms||361!!Adenocarcinoma||331!!Disease Progression||302!!Intestinal Neoplasms||172!!Head and Neck Neoplasms||170
AGE-RAGE Signaling Pathway In Diabetic Complications||1320037!!AGE-RAGE Signaling Pathway In Diabetic Complications||1319775!!Activation Of BAD And Translocation To Mitochondria Pathway||1323533!!Activation Of BH3-only Proteins Pathway||1323532!!Adrenergic Signaling In Cardiomyocytes Pathway||908268!!Adrenergic Signaling In Cardiomyocytes Pathway||909696!!Amyotrophic Lateral Sclerosis (ALS) Pathway||83296!!Amyotrophic Lateral Sclerosis (ALS) Pathway||511!!Apoptosis Pathway||198339!!Apoptosis Pathway||83257
aaa23184 mouse recombinant and natural apoptosis regulator bcl 2 typical testing data standard curve for reference only aaa23184_sc elisa kit bcl2 isoform 1 b cell leukemia lymphoma aw986256 c430015f12rik d630044d05rik d830018m01rik 22,281 da bcl2_mouse 133892547 np_033871.2 p10417 nm_009741.5 p10418 q4vbf6 samples serum plasma tissue homogenates culture supernates or other biological fluids detection range 0.156 10 ng ml sensitivity < 0.087 intra assay precision <=6.3 inter <=8.2 isoform1
⇄concentration => string (41) "0.25 mg/ml (determined by Bradford assay)"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (200) "Can be stored at 2 degree C to 8 degree C for 1 week.<br>For long term stora...
$value[8]['_source']['storage_stability']
Can be stored at 2 degree C to 8 degree C for 1 week.<br>For long term storage, aliquot and store at -20 degree C or -80 degree C.<br>Avoid repeated freezing and thawing cycles.<br>Ships with dry ice.
induced myeloid leukemia cell differentiation protein Mcl-1; BCL2L3; mcl1/EAT; myeloid cell leukemia sequence 1; Bcl-2-like protein 3
⇄products_gene_name => string (4) "MCL1"
$value[8]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[8]['_source']['products_gene_name_syn']
⇄⧉products_description => string (646) "MCL1, also known as BCL2L3, belongs to the Bcl-2 family. MCL1 is involved in...
$value[8]['_source']['products_description']
MCL1, also known as BCL2L3, belongs to the Bcl-2 family. MCL1 is involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. Recombinant human MCL1 protein, fused to His-tag at N-terminus, was expressed in E Coli and purified by using conventional chromatography techniques
⇄⧉products_references => string (111) "Bingle C.D., et al. (2000) J. Biol. Chem. 275:22136-22146; Bae J., et al. (2...
$value[8]['_source']['products_references']
Bingle C.D., et al. (2000) J. Biol. Chem. 275:22136-22146; Bae J., et al. (2000) J. Biol. Chem. 275:25255-25261
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[9]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[9]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[9]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[9]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 35ug/ml<br>Applications are based on unconjugated antibody."
$value[9]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[9]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA24441_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA24441_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA24441_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA24441_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA24441_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA24441_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA24441_WB.jpg
⇄⧉etc_term1 => string (275) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[9]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||APC
⇄⧉search_terms => string (1187) "aaa24441 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[9]['_source']['search_terms']
aaa24441 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes bag1 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 35ug ml applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa24441_wb immunoperoxidase 1238051 3ug formalin fixed paraffin embedded tonsil aaa24441_ihc2 hela cell aaa24441_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa24441_td4 jurkat aaa24441_wb5 against immunogen 37.29kd aaa24441_wb6 aaa24441_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[10]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[10]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[10]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[10]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 35ug/ml<br>Applications are based on unconjugated antibody."
$value[10]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[10]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA24736_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA24736_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA24736_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA24736_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA24736_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA24736_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA24736_WB.jpg
⇄⧉etc_term1 => string (278) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[10]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||Biotin
⇄⧉search_terms => string (1174) "aaa24736 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[10]['_source']['search_terms']
aaa24736 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes bag1 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 35ug ml applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa24736_wb immunoperoxidase 1238051 3ug formalin fixed paraffin embedded tonsil aaa24736_ihc2 hela cell aaa24736_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa24736_td4 jurkat aaa24736_wb5 against immunogen 37.29kd aaa24736_wb6 aaa24736_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of M...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of MCL1. No significant cross-reactivity or interference between MCL1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[11]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_name_syn => string (274) "MCL1/BCL2L3/bcl2-L-3/Bcl2-L-3/MGC104264/Bcl-2-like protein 3/Bcl-2-related p...
$value[11]['_source']['products_name_syn']
MCL1/BCL2L3/bcl2-L-3/Bcl2-L-3/MGC104264/Bcl-2-like protein 3/Bcl-2-related protein EAT/mcl1/EAT/induced myeloid leukemia cell differentiation protein Mcl-1/Mcl-1/mcl1/EAT/MCL1-ES/MCL1L/MCL1S/MGC1839/myeloid cell leukemia ES/myeloid cell leukemia sequence 1 (BCL2-related)/TM
⇄products_gene_name => string (4) "MCL1"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[11]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (681) "aaa17552 human this assay has high sensitivity and excellent specificity for...
$value[11]['_source']['search_terms']
aaa17552 human this assay has high sensitivity and excellent specificity for detection of mcl1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17552_sc elisa kit induced myeloid leukemia cell differentiation protein mcl 1 bcl2l3 bcl2 l 3 mgc104264 bcl 2 like related eat es mcl1l mcl1s mgc1839 sequence tm isoform 28,662 da mcl1_human 309747067 np_001184249.1 q07820 nm_001197320.1 q9hd91 q9nrq3 q9nrq4 q9uhr7 q9uhr8 q9uhr9 q9unj1 b2r6b2 d3dv03 d3dv04 159552 samples lysates tissue homogenates other biological fluids type quantitative sandwich range 31.25 2000pg ml 18.75pg intra precision cv l3
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[12]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[12]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[12]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[12]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[12]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[12]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[12]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA25329_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA25329_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA25329_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA25329_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA25329_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA25329_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA25329_WB.jpg
⇄⧉etc_term1 => string (275) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[12]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||HRP
⇄⧉search_terms => string (1196) "aaa25329 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[12]['_source']['search_terms']
aaa25329 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes bag1 species crossreactivity and elisa eia immunohistochemistry ihc paraffin western blot wb p 3ug ml applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa25329_wb immunoperoxidase 1238051 formalin fixed embedded tonsil aaa25329_ihc2 immunofluorescence if 35ug hela cell aaa25329_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25329_td4 jurkat aaa25329_wb5 against immunogen 37.29kd aaa25329_wb6 aaa25329_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄⧉testing_protocols => string (1493) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Bcl-XL ant...
$value[13]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Bcl-XL antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30008_FCM7.jpg!!ICC (Immunocytochemistry)||ICC staining Bcl-XL in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30008_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Bcl-XL in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30008_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining Bcl-XL in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30008_ICC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using anti-Bcl-XL antibody. Counter stained with hematoxylin.||AAA30008_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-Bcl-XL antibody. Counter stained with hematoxylin.||AAA30008_IHC2.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-Bcl-XL antibody. Counter stained with hematoxylin.||AAA30008_IHC.jpg
Apoptosis regulator Bcl X antibody; Apoptosis regulator Bcl-X antibody; Apoptosis regulator BclX antibody; B cell lymphoma 2 like antibody; B2CL1_HUMAN antibody; Bcl 2 like 1 protein antibody; Bcl X antibody; Bcl xL antibody; BCL XL/S antibody; Bcl xS antibody; Bcl-2-like protein 1 antibody; Bcl2 Like 1 antibody; Bcl2 related gene antibody; Bcl2-L-1 antibody; BCL2L antibody; Bcl2l1 antibody; BCLX antibody; BclXL antibody; BclXs antibody; DKFZp781P2092 antibody; PPP1R52 antibody; Protein phosphatase 1 regulatory subunit 52 antibody
⇄products_gene_name => string (6) "BCL-XL"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1137) "The Bcl-2 gene was isolated at the chromosomal breakpoint of t (14;18) beari...
$value[13]['_source']['products_description']
The Bcl-2 gene was isolated at the chromosomal breakpoint of t (14;18) bearing follicular B cell lymphomas. Bcl-2 blocks cell death following a variety of stimuli and confers a death-sparing effect to certain hematopoietic cell lines following growth factor withdrawal. A second protein, designated Bcl-associated X protein (Bax) p21, has extensive amino acid homology with Bcl-2 and both homodimerizes and heterodimerizes with Bcl-2. Overexpression of Bax accelerates apoptotic death induced by cytokine deprivation in an IL-3-dependent cell line, and Bax also counters the death repressor activity of Bcl-2. Bcl-x, one of several additional proteins with sequence homology to Bcl-2, is expressed as Bcl-xL, a 233 amino acid protein with 43% sequence identity with Bcl-2 that suppresses cell death, and Bcl-xS, a shorter variant that is 178 amino acids in length and lacks a 63 amino acid region (amino acids 126-188) found in Bcl-xL and which functions as a dominant inhibitor of Bcl-2. A further apoptosis-inducing protein, Bad, dimerizes both with Bcl-xL and to a lesser extent with Bcl-2, thus displacing Bax and inducing apoptosis.
⇄products_references => string (3) "N/A"
$value[13]['_source']['products_references']
⇄⧉products_related_diseases => string (223) "Neoplasms||2372!!Carcinoma||793!!Necrosis||629!!Nervous System Diseases||357...
⇄⧉search_terms => string (1214) "aaa30008 rabbit human mouse rat monoclonal sz3 03 proa affinity purified 1*t...
$value[13]['_source']['search_terms']
aaa30008 rabbit human mouse rat monoclonal sz3 03 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc immunoprecipitation ip flow cytometry fc facs 1:1000 1:50 1:200 1:100 immunohistochemical analysis of paraffin embedded colon cancer tissue using anti bcl xl antibody counter stained with hematoxylin aaa30008_ihc kidney aaa30008_ihc2 breast carcinoma aaa30008_ihc3 staining in hepg2 cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30008_icc4 hela aaa30008_icc5 mcf 7 aaa30008_icc6 cytometric at 50 dilution red compared an unlabelled control without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30008_fc7 apoptosis regulator x bclx b cell lymphoma 2 like b2cl1_human protein s xs bcl2 related gene l bcl2l bcl2l1 bclxl bclxs dkfzp781p2092 ppp1r52 phosphatase regulatory subunit 52 isoform 26,049 da 4502381 np_001182.1 q07817 nm_001191.2 q5cz89 q5te65 q92976 e1p5l6 600039 total ab type recombinant immunogen conjugation unconjugated sz303 ph7.41 bsa40 mcf7 at50 fluor488 lymphoma2 subunit52
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[14]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[14]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[14]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[14]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 35ug/ml<br>Applications are based on unconjugated antibody."
$value[14]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[14]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA25622_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA25622_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA25622_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA25622_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA25622_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA25622_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA25622_WB.jpg
⇄⧉etc_term1 => string (274) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[14]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||PE
⇄⧉search_terms => string (1186) "aaa25622 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[14]['_source']['search_terms']
aaa25622 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes bag1 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 35ug ml applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa25622_wb immunoperoxidase 1238051 3ug formalin fixed paraffin embedded tonsil aaa25622_ihc2 hela cell aaa25622_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25622_td4 jurkat aaa25622_wb5 against immunogen 37.29kd aaa25622_wb6 aaa25622_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[15]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[15]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[15]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[15]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
$value[15]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[15]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[15]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA24146_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA24146_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA24146_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA24146_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA24146_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA24146_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA24146_WB.jpg
⇄⧉etc_term1 => string (274) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[15]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||AP
⇄⧉search_terms => string (1191) "aaa24146 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[15]['_source']['search_terms']
aaa24146 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes bag1 species crossreactivity and elisa eia immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa24146_wb immunoperoxidase 1238051 3ug ml formalin fixed paraffin embedded tonsil aaa24146_ihc2 immunofluorescence if 35ug hela cell aaa24146_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa24146_td4 jurkat aaa24146_wb5 against immunogen 37.29kd aaa24146_wb6 aaa24146_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄specificity => string (62) "Recognizes human BAG1. Species Crossreactivity: mouse and rat."
$value[16]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[16]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 35ug/ml<br>Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (762) "WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 ex...
$value[16]['_source']['testing_protocols']
WB (Western Blot)||BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa.||AAA25033_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.29kD).||AAA25033_WB6.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in Jurkat using 123805.||AAA25033_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged BAG1 is ~0.03ng/ml as a capture antibody.||AAA25033_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of 123805 (35ug/ml) on HeLa cell.||AAA25033_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of 1238051 (3ug/ml) on formalin-fixed paraffin-embedded human tonsil.||AAA25033_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of BAG1 expression in NIH/3T3 using 123805.||AAA25033_WB.jpg
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (N...
$value[16]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE!!Conjugate||FITC
⇄⧉search_terms => string (1199) "aaa25033 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affini...
$value[16]['_source']['search_terms']
aaa25033 mouse human rat monoclonal igg2a,k 2d3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes bag1 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 35ug ml applications are based on unconjugated antibody analysis of expression nih 3t3 using 123805 aaa25033_wb immunoperoxidase 1238051 3ug formalin fixed paraffin embedded tonsil aaa25033_ihc2 hela cell aaa25033_if3 testing data detection limit for recombinant gst tagged is ~0.03ng capture aaa25033_td4 jurkat aaa25033_wb5 against immunogen 37.29kd aaa25033_wb6 aaa25033_wb7 bag family molecular chaperone regulator 1 bcl 2 associated athanogene bcl2 rap46 isoform 1l hap binding receptor 46 kd associating glucocortoid 25,989 da bag1_human 124494251 np_004314 q99933 nm_004323 o75315 q14414 q53h32 q5vze8 q5vze9 q5vzf0 q96tg2 q9y2v4 601497 antibodies apoptosis partial corresponding to aa241 345 from tag mw the alone 26kd sequence ekiadqleelnkeltgiqqgflpkdlqaealckldrrvkatieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqeterlqstnfalae conjugate ph7.2 regulator1 receptor46 aa241345
⇄⧉testing_protocols => string (1065) "IF (Immunofluorescence)||Immunofluorescence analysis of BT-20 cells using MC...
$value[17]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of BT-20 cells using MCL1 antibody.||AAA28233_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using MCL1 antibody.||AAA28233_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of HepG2 cells using MCL1 antibody.||AAA28233_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human kidney using MCL1 antibody at dilution of 1:100 (40x lens).||AAA28233_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human breast using MCL1 antibody at dilution of 1:100 (40x lens).||AAA28233_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human pancreas using MCL1 antibody at dilution of 1:100 (40x lens).||AAA28233_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using MCL1 antibody.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.||AAA28233_WB.jpg
⇄etc_term1 => string (44) "Immunogen||Recombinant protein of human MCL1"
⇄⧉products_description => string (351) "This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 ...
$value[17]['_source']['products_description']
This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.
⇄⧉products_description => string (828) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[18]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rabbit BCL-2 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉testing_protocols => string (868) "WB (Western Blot)||Western blot analysis of extracts of various cell lines, ...
$value[19]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of extracts of various cell lines, using BAG3 antibody at 1:1000 dilution.||AAA30572_WB6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse heart using BAG3 antibody at dilution of 1:100 .||AAA30572_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human breast cancer using BAG3 antibody at dilution of 1:100 .||AAA30572_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using BAG3 antibody at dilution of 1:100 .||AAA30572_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung using BAG3 antibody at dilution of 1:100 .||AAA30572_IHC2.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat heart using BAG3 antibody at dilution of 1:100 .||AAA30572_IHC.jpg
⇄etc_term1 => string (65) "Immunogen||Recombinant fusion protein of human BAG3 (NP_004272.2)"
⇄⧉products_description => string (621) "BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain a...
$value[19]['_source']['products_description']
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (212) "Neoplasms||48!!Nervous System Diseases||24!!Brain Diseases||8!!Heart Disease...
⇄⧉search_terms => string (788) "aaa30572 rabbit human mouse rat polyclonal igg affinity purification supplie...
$value[19]['_source']['search_terms']
aaa30572 rabbit human mouse rat polyclonal igg affinity purification supplied at 1.0mg ml in phosphate buffered saline without mg2+ and ca2+ ph7.4 150mm nacl 0.02 sodium azide 90 glycerol pbs with 50 ph7.43 western blot wb immunohistochemistry ihc immunofluorescence if immunoprecipitation ip 1:500 1:2000 1:50 1:100 of paraffin embedded heart using bag3 antibody dilution aaa30572_ihc lung aaa30572_ihc2 cancer aaa30572_ihc3 breast aaa30572_ihc4 aaa30572_ihc5 analysis extracts various cell lines 1:1000 aaa30572_wb6 bag 3 bis cair 1 mfm6 family molecular chaperone regulator bcl2 associated athanogene docking protein binding bcl 2 61,595 da bag3_human 14043024 np_004272.2 o95817 nm_004281.3 q3b763 q9nt20 q9p120 a8k5l8 603883 total ab immunogen recombinant fusion azide90 with50 cair1
