Rabbit anti-Human AADAT Polyclonal Antibody | anti-AADAT antibody

AADAT (KAT2, Kynurenine/alpha-aminoadipate Aminotransferase, Mitochondrial, 2-aminoadipate Aminotransferase, 2-aminoadipate Transaminase, Alpha-aminoadipate Aminotransferase, Kynurenine Aminotransferase II, Kynurenine-oxoglutarate Aminotransferase II, Kyn

Cat. Num. AAA6368365

• Gene Names: AADAT; KAT2; KATII; KYAT2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AADAT; Polyclonal Antibody; AADAT (KAT2; Kynurenine/alpha-aminoadipate Aminotransferase; Mitochondrial; 2-aminoadipate Aminotransferase; 2-aminoadipate Transaminase; Alpha-aminoadipate Aminotransferase; Kynurenine Aminotransferase II; Kynurenine-oxoglutarate Aminotransferase II; Kyn; anti-AADAT antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AADAT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 2128

• Applicable Applications for anti-AADAT antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AADAT, aa1-429 (AAH31068.1).
• Immunogen Sequence: MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AADAT expression in transfected 293T cell line by AADAT usingMBS6001465. Lane 1: AADAT transfected lysate (47.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AADAT antibody

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist.

Product Categories/Family for anti-AADAT antibody

Antibodies; Enzymes; Aminotransferase

NCBI and Uniprot Product Information

• NCBI GI #: 21410575
• NCBI GeneID: 51166
• NCBI Official Full Name: Homo sapiens aminoadipate aminotransferase, mRNA
• NCBI Official Synonym Full Names: aminoadipate aminotransferase
• NCBI Official Symbol: AADAT
• NCBI Official Synonym Symbols: KAT2; KATII; KYAT2
• NCBI Protein Information: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
• Protein Family: Kynurenine/alpha-aminoadipate aminotransferase

NCBI Description

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]