Western Blot (WB)
(WB Suggested Anti-A1BG AntibodyTitration: 5 ug/mlPositive Control: human liver, human serum, human plasma)
Rabbit anti-Human A1BG Polyclonal Antibody | anti-A1BG antibody
A1BG antibody - N-terminal region
Gene Names
A1BG; A1B; ABG; GAB; HYST2477
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
A1BG; Polyclonal Antibody; A1BG antibody - N-terminal region; anti-A1BG antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
Sequence Length
495
Applicable Applications for anti-A1BG antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-A1BG AntibodyTitration: 5 ug/mlPositive Control: human liver, human serum, human plasma)
Western Blot (WB)
(WB Suggested Anti-A1BG AntibodyTitration: 5 ug/mlPositive Control: human liver, human serum, human plasma)
Western Blot (WB)
(WB Suggested Anti-A1BG Antibody Titration: 0.1ug/ml Positive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-A1BG Antibody Titration: 0.1ug/ml Positive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-A1BG antibody
This is a rabbit polyclonal antibody against A1BG. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BX325198.2 1-7 8-1722 AB073611.1 1-1715 1723-1766 AK056201.1 462-505
Target Description: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BX325198.2 1-7 8-1722 AB073611.1 1-1715 1723-1766 AK056201.1 462-505
Product Categories/Family for anti-A1BG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
alpha-1B-glycoprotein
NCBI Official Synonym Full Names
alpha-1-B glycoprotein
NCBI Official Symbol
A1BG
NCBI Official Synonym Symbols
A1B; ABG; GAB; HYST2477
NCBI Protein Information
alpha-1B-glycoprotein
UniProt Protein Name
Alpha-1B-glycoprotein
Protein Family
UniProt Gene Name
A1BG
UniProt Entry Name
A1BG_HUMAN
NCBI Description
The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. [provided by RefSeq, Jul 2008]
Uniprot Description
A1BG: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 19q13.4
Cellular Component: extracellular space; extracellular region
Research Articles on A1BG
1. cardiovascular outcomes may differ based on A1BG genotype, and antihypertensive treatment strategy.
Similar Products
Product Notes
The A1BG a1bg (Catalog #AAA3201732) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A1BG antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A1BG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the A1BG a1bg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITPGLKTTAV CRGVLRGVTF LLRREGDHEF LEVPEAQEDV EATFPVHQPG. It is sometimes possible for the material contained within the vial of "A1BG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
