Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '11044'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.12 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '11044' and pd.language_id = 1
Query
Database
1.69 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11044'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.65 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '11044'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '11044' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11044'
⇄purity => string (70) "AIMF2 Antibody is affinity chromatography purified via peptide column."
$value['purity']
⇄form => string (72) "Liquid; AIFM2 Antibody is supplied in PBS containing 0.02% sodium azide."
$value['form']
⇄concentration => string (6) "1mg/mL"
$value['concentration']
⇄⧉storage_stability => string (251) "AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C...
$value['storage_stability']
AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
$value['app_tested']
⇄⧉app_notes => string (247) "WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in hu...
$value['app_notes']
WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunofluorescence in human samples and Immunohistochemistry in human mouse and rat samples. All other applications and species not yet tested.
IHC (Immunohistochemistry)||<strong>Figure 7: Immunohistochemistry Validation of AIFM2 in Rat Testis</strong><br>Immunohistochemical analysis of paraffin-embedded rat testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC7.jpg!!IHC (Immunohistchemistry)||<strong>Figure 6: Immunohistochemistry Validation of AIFM2 in Mouse Spleen</strong><br>Immunohistochemical analysis of paraffin-embedded mouse spleen tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC6.jpg!!IHC (Immunohistochemistry)||<strong>Figure 5: Immunohistochemistry Validation of AIFM2 in Human Testis</strong><br>Immunohistochemical analysis of paraffin-embedded human testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC5.jpg!!IF (Immunofluorescence)||<strong>Figure 4: Immunofluorescence Validation of AIFM2 in HeLa Cells</strong><br>Immunofluorescent analysis of 4% paraformaldehyde-fixed HeLa cells labeling AIFM2 with AAA11044 at 20ug/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (green) and DAPI staining (blue).||AAA11044_IF4.jpg!!WB (Western Blot)||<strong>Figure 3: WB Validation in Rat Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB3.gif!!WB (Western Blot)||<strong>Figure 2: WB Validation in Mouse Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB2.gif!!WB (Western Blot)||<strong>Figure 1: WB Validation in Human Mouse and Rat Cell Lines</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB.gif
⇄⧉etc_term1 => string (417) "Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a...
$value['etc_term1']
Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a peptide corresponding to 12 amino acids near the carboxyl terminus of human AIFM2. The immunogen is located within the last 50 amino acids of AIFM2.!!Homology||Predicted species reactivity based on immunogen sequence: Gorilla (100%); chimpanzee (100%), cow (92%), Horse (92%)!!Research Area||Signal Transduction!!NCBI Organism||Homo sapiens
⇄⧉etc_term2 => string (274) "Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) an...
$value['etc_term2']
Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) and isoform 2 (336aa, 36.5kD). Mouse AIFM2 has 2 isoforms, isoform 1 (373aa, 40.6kD) and isoform 2 (380aa, 41.4kD). Rat AIFM2 has one isoform (373aa, 40.7kD). can detect AIFM2 in human, mouse and rat.
AIFM2 Antibody: AIFM2 blocks ferroptosis independent of ubiquinol metabolism. AIFM2 is a key component of a non-mitochondrial CoQ antioxidant system that acts in parallel to the canonical glutathione-based GPX4 pathway. AIFM2 confers protection against ferroptosis elicited by GPX4 deletion. AIF-2 was found to be upregulated in human glioma tissues and cell lines. Downregulation of AIF-2 reduced cell proliferation and induced G1 cell cycle arrest. AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type). AIF-M2 lessens survival cell signaling in the presence of foreign (e.g. bacterial and (retro)viral) cytosolic DNA, thus contributing to the onset of apoptosis
⇄⧉products_references => string (259) "Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et a...
$value['products_references']
Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et al. Nature 2019; 575(7784):688-692<br>Doll et al. Nature 2019; 575(7784):693-698<br>Chen et al. J Mol Neurosci 2019; 68(2): 304-310<br>Gong et al. J Biol Chem 2007; 282(41):30331-30340
⇄purity => string (70) "AIMF2 Antibody is affinity chromatography purified via peptide column."
$value->a['purity']
⇄form => string (72) "Liquid; AIFM2 Antibody is supplied in PBS containing 0.02% sodium azide."
$value->a['form']
⇄concentration => string (6) "1mg/mL"
$value->a['concentration']
⇄⧉storage_stability => string (251) "AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C...
$value->a['storage_stability']
AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
$value->a['app_tested']
⇄⧉app_notes => string (247) "WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in hu...
$value->a['app_notes']
WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunofluorescence in human samples and Immunohistochemistry in human mouse and rat samples. All other applications and species not yet tested.
IHC (Immunohistochemistry)||<strong>Figure 7: Immunohistochemistry Validation of AIFM2 in Rat Testis</strong><br>Immunohistochemical analysis of paraffin-embedded rat testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC7.jpg!!IHC (Immunohistchemistry)||<strong>Figure 6: Immunohistochemistry Validation of AIFM2 in Mouse Spleen</strong><br>Immunohistochemical analysis of paraffin-embedded mouse spleen tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC6.jpg!!IHC (Immunohistochemistry)||<strong>Figure 5: Immunohistochemistry Validation of AIFM2 in Human Testis</strong><br>Immunohistochemical analysis of paraffin-embedded human testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC5.jpg!!IF (Immunofluorescence)||<strong>Figure 4: Immunofluorescence Validation of AIFM2 in HeLa Cells</strong><br>Immunofluorescent analysis of 4% paraformaldehyde-fixed HeLa cells labeling AIFM2 with AAA11044 at 20ug/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (green) and DAPI staining (blue).||AAA11044_IF4.jpg!!WB (Western Blot)||<strong>Figure 3: WB Validation in Rat Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB3.gif!!WB (Western Blot)||<strong>Figure 2: WB Validation in Mouse Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB2.gif!!WB (Western Blot)||<strong>Figure 1: WB Validation in Human Mouse and Rat Cell Lines</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB.gif
⇄⧉etc_term1 => string (417) "Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a...
$value->a['etc_term1']
Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a peptide corresponding to 12 amino acids near the carboxyl terminus of human AIFM2. The immunogen is located within the last 50 amino acids of AIFM2.!!Homology||Predicted species reactivity based on immunogen sequence: Gorilla (100%); chimpanzee (100%), cow (92%), Horse (92%)!!Research Area||Signal Transduction!!NCBI Organism||Homo sapiens
⇄⧉etc_term2 => string (274) "Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) an...
$value->a['etc_term2']
Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) and isoform 2 (336aa, 36.5kD). Mouse AIFM2 has 2 isoforms, isoform 1 (373aa, 40.6kD) and isoform 2 (380aa, 41.4kD). Rat AIFM2 has one isoform (373aa, 40.7kD). can detect AIFM2 in human, mouse and rat.
AIFM2 Antibody: AIFM2 blocks ferroptosis independent of ubiquinol metabolism. AIFM2 is a key component of a non-mitochondrial CoQ antioxidant system that acts in parallel to the canonical glutathione-based GPX4 pathway. AIFM2 confers protection against ferroptosis elicited by GPX4 deletion. AIF-2 was found to be upregulated in human glioma tissues and cell lines. Downregulation of AIF-2 reduced cell proliferation and induced G1 cell cycle arrest. AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type). AIF-M2 lessens survival cell signaling in the presence of foreign (e.g. bacterial and (retro)viral) cytosolic DNA, thus contributing to the onset of apoptosis
⇄⧉products_references => string (259) "Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et a...
$value->a['products_references']
Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et al. Nature 2019; 575(7784):688-692<br>Doll et al. Nature 2019; 575(7784):693-698<br>Chen et al. J Mol Neurosci 2019; 68(2): 304-310<br>Gong et al. J Biol Chem 2007; 282(41):30331-30340
⇄purity => string (70) "AIMF2 Antibody is affinity chromatography purified via peptide column."
$value->d['purity']
⇄form => string (72) "Liquid; AIFM2 Antibody is supplied in PBS containing 0.02% sodium azide."
$value->d['form']
⇄concentration => string (6) "1mg/mL"
$value->d['concentration']
⇄⧉storage_stability => string (251) "AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C...
$value->d['storage_stability']
AIMF2 antibody can be stored at 4 degree C for three months and -20 degree C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
$value->d['app_tested']
⇄⧉app_notes => string (247) "WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in hu...
$value->d['app_notes']
WB: 2ug/mL; IHC: 1ug/mL; IF: 20ug/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunofluorescence in human samples and Immunohistochemistry in human mouse and rat samples. All other applications and species not yet tested.
IHC (Immunohistochemistry)||<strong>Figure 7: Immunohistochemistry Validation of AIFM2 in Rat Testis</strong><br>Immunohistochemical analysis of paraffin-embedded rat testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC7.jpg!!IHC (Immunohistchemistry)||<strong>Figure 6: Immunohistochemistry Validation of AIFM2 in Mouse Spleen</strong><br>Immunohistochemical analysis of paraffin-embedded mouse spleen tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC6.jpg!!IHC (Immunohistochemistry)||<strong>Figure 5: Immunohistochemistry Validation of AIFM2 in Human Testis</strong><br>Immunohistochemical analysis of paraffin-embedded human testis tissue using anti-AIFM2 antibody (AAA11044) at 1ug/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 degree C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.||AAA11044_IHC5.jpg!!IF (Immunofluorescence)||<strong>Figure 4: Immunofluorescence Validation of AIFM2 in HeLa Cells</strong><br>Immunofluorescent analysis of 4% paraformaldehyde-fixed HeLa cells labeling AIFM2 with AAA11044 at 20ug/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (green) and DAPI staining (blue).||AAA11044_IF4.jpg!!WB (Western Blot)||<strong>Figure 3: WB Validation in Rat Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB3.gif!!WB (Western Blot)||<strong>Figure 2: WB Validation in Mouse Tissues</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB2.gif!!WB (Western Blot)||<strong>Figure 1: WB Validation in Human Mouse and Rat Cell Lines</strong><br>Loading: 15ug of lysate. Antibodies: AIFM2 AAA11044, 2ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjuate at 1:10,000 dilution.||AAA11044_WB.gif
⇄⧉etc_term1 => string (417) "Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a...
$value->d['etc_term1']
Immunogen||Anti-AIFM2 antibody (<strong> 9653</strong>) was raised against a peptide corresponding to 12 amino acids near the carboxyl terminus of human AIFM2. The immunogen is located within the last 50 amino acids of AIFM2.!!Homology||Predicted species reactivity based on immunogen sequence: Gorilla (100%); chimpanzee (100%), cow (92%), Horse (92%)!!Research Area||Signal Transduction!!NCBI Organism||Homo sapiens
⇄⧉etc_term2 => string (274) "Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) an...
$value->d['etc_term2']
Isoforms||Human AIFM2 has 2 isoforms, including isoform 1 (373aa, 40.5kD) and isoform 2 (336aa, 36.5kD). Mouse AIFM2 has 2 isoforms, isoform 1 (373aa, 40.6kD) and isoform 2 (380aa, 41.4kD). Rat AIFM2 has one isoform (373aa, 40.7kD). can detect AIFM2 in human, mouse and rat.
AIFM2 Antibody: AIFM2 blocks ferroptosis independent of ubiquinol metabolism. AIFM2 is a key component of a non-mitochondrial CoQ antioxidant system that acts in parallel to the canonical glutathione-based GPX4 pathway. AIFM2 confers protection against ferroptosis elicited by GPX4 deletion. AIF-2 was found to be upregulated in human glioma tissues and cell lines. Downregulation of AIF-2 reduced cell proliferation and induced G1 cell cycle arrest. AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type). AIF-M2 lessens survival cell signaling in the presence of foreign (e.g. bacterial and (retro)viral) cytosolic DNA, thus contributing to the onset of apoptosis
⇄⧉products_references => string (259) "Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et a...
$value->d['products_references']
Dai et al. Biochem Biophys Res Commun. 2020; 523(4):966-971<br>Bersuker et al. Nature 2019; 575(7784):688-692<br>Doll et al. Nature 2019; 575(7784):693-698<br>Chen et al. J Mol Neurosci 2019; 68(2): 304-310<br>Gong et al. J Biol Chem 2007; 282(41):30331-30340
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[0]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (975) "Intended Uses: This sandwich kit is for the accurate quantitative detection ...
$value[0]['_source']['products_description']
Intended Uses: This sandwich kit is for the accurate quantitative detection of human Soluble Vascular Endothelial Growth Factor Receptor-3 (also known as SVEGFR-3/SFLT-4) in serum, plasma, cell culture supernates, cell lysates, tissue homogenates.<br><br>Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with human SVEGFR-3/SFLT-4 antibody. SVEGFR-3/SFLT-4 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated human SVEGFR-3/SFLT-4 Antibody is added and binds to SVEGFR-3/SFLT-4 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated SVEGFR-3/SFLT-4 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of human SVEGFR-3/SFLT-4. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.
⇄⧉search_terms => string (1030) "aaa11288 human typical testing data standard curve for reference only aaa112...
$value[0]['_source']['search_terms']
aaa11288 human typical testing data standard curve for reference only aaa11288_sc elisa kit sonic hedgehog homolog shh protein isoform 1 preproprotein tpt hhg1 hlp3 hpe3 smmci shhnc tptps mcopcb5 49,607 da hhg unprocessed n terminal signaling and c autoprocessing domains1 publicationmanual assertion based on opinion iniref.16"scube2 enhances proteolytic processing from the surface of producing cells."jakobs p exner s schuermann pickhinke u bandari ortmann kupich schulz hansen seidler d.g grobe k.j cell sci 127:1726 1737 2014 pubmed europe pmc abstract cited ptm interaction with scube2 subunit subcellular location function caution shhnc1 iniref.16 shhn shhnp1 4506939 np_000184.1 q15465 nm_000193.3 q75mc9 a4d247 samples serum plasma culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 0.1ng ml 35ng sensitivity 0.041ng intra precision within an three known concentration were tested one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 isoform1 x100
⇄specificity => string (22) "Recognizes human HHIP."
$value[1]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[1]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[1]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[1]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[1]['_source']['app_notes']
⇄⧉testing_protocols => string (1036) "WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP e...
$value[1]['_source']['testing_protocols']
WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.||AAA25713_WB7.jpg!!WB (Western Blot)||HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.||AAA25713_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.||AAA25713_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.||AAA25713_IP4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].||AAA25713_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.||AAA25713_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.11kD).||AAA25713_WB.jpg
⇄⧉etc_term1 => string (268) "Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP...
$value[1]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ!!Conjugate||PE
⇄⧉search_terms => string (1124) "aaa25713 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity ...
$value[1]['_source']['search_terms']
aaa25713 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes hhip elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.11kd aaa25713_wb analysis of expression transfected 293t cell line lane 1 lysate 78.9kd 2 non aaa25713_wb2 immunoperoxidase to formalin fixed embedded heart concentration aaa25713_ihc3 using and magnetic bead immunoblotted rabbit polyclonal aaa25713_ip4 testing data limit for recombinant gst tagged is ~1ng capture aaa25713_td5 hela ne aaa25713_wb6 mcf 7 aaa25713_wb7 hedgehog interacting hip unq5825 pro19644 flj20992 flj90230 36,373 da hhip_human 20143973 np_071920 q96qv1 nm_022475 q6pk09 q8nci7 q9bxk3 q9h1j4 q9h7e7 606178 antibodies sonic shh partial corresponding aa21 121 from tag mw the alone 26kd sequence gdakfgernegsgarrrrclngnppkrlkrrdrrmmsqlellsggemlcggfyprlscclrsdspglgrlenkifsvtnntecgklleeikcalcsphsq conjugate ph7.2 lane1 78.9kd2 mcf7 aa21121
⇄specificity => string (22) "Recognizes human HHIP."
$value[2]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[2]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[2]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[2]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[2]['_source']['app_notes']
⇄⧉testing_protocols => string (1036) "WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP e...
$value[2]['_source']['testing_protocols']
WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.||AAA24532_WB7.jpg!!WB (Western Blot)||HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.||AAA24532_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.||AAA24532_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.||AAA24532_IP4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].||AAA24532_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.||AAA24532_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.11kD).||AAA24532_WB.jpg
⇄⧉etc_term1 => string (269) "Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP...
$value[2]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ!!Conjugate||APC
⇄⧉search_terms => string (1125) "aaa24532 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity ...
$value[2]['_source']['search_terms']
aaa24532 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes hhip elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.11kd aaa24532_wb analysis of expression transfected 293t cell line lane 1 lysate 78.9kd 2 non aaa24532_wb2 immunoperoxidase to formalin fixed embedded heart concentration aaa24532_ihc3 using and magnetic bead immunoblotted rabbit polyclonal aaa24532_ip4 testing data limit for recombinant gst tagged is ~1ng capture aaa24532_td5 hela ne aaa24532_wb6 mcf 7 aaa24532_wb7 hedgehog interacting hip unq5825 pro19644 flj20992 flj90230 36,373 da hhip_human 20143973 np_071920 q96qv1 nm_022475 q6pk09 q8nci7 q9bxk3 q9h1j4 q9h7e7 606178 antibodies sonic shh partial corresponding aa21 121 from tag mw the alone 26kd sequence gdakfgernegsgarrrrclngnppkrlkrrdrrmmsqlellsggemlcggfyprlscclrsdspglgrlenkifsvtnntecgklleeikcalcsphsq conjugate ph7.2 lane1 78.9kd2 mcf7 aa21121
⇄specificity => string (22) "Recognizes human HHIP."
$value[3]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[3]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[3]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[3]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[3]['_source']['app_notes']
⇄⧉testing_protocols => string (1036) "WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP e...
$value[3]['_source']['testing_protocols']
WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.||AAA24827_WB7.jpg!!WB (Western Blot)||HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.||AAA24827_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.||AAA24827_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.||AAA24827_IP4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].||AAA24827_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.||AAA24827_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.11kD).||AAA24827_WB.jpg
⇄⧉etc_term1 => string (272) "Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP...
$value[3]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ!!Conjugate||Biotin
⇄⧉search_terms => string (1112) "aaa24827 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity ...
$value[3]['_source']['search_terms']
aaa24827 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes hhip elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.11kd aaa24827_wb analysis of expression transfected 293t cell line lane 1 lysate 78.9kd 2 non aaa24827_wb2 immunoperoxidase to formalin fixed embedded heart concentration aaa24827_ihc3 using and magnetic bead immunoblotted rabbit polyclonal aaa24827_ip4 testing data limit for recombinant gst tagged is ~1ng capture aaa24827_td5 hela ne aaa24827_wb6 mcf 7 aaa24827_wb7 hedgehog interacting hip unq5825 pro19644 flj20992 flj90230 36,373 da hhip_human 20143973 np_071920 q96qv1 nm_022475 q6pk09 q8nci7 q9bxk3 q9h1j4 q9h7e7 606178 antibodies sonic shh partial corresponding aa21 121 from tag mw the alone 26kd sequence gdakfgernegsgarrrrclngnppkrlkrrdrrmmsqlellsggemlcggfyprlscclrsdspglgrlenkifsvtnntecgklleeikcalcsphsq conjugate ph7.2 lane1 78.9kd2 mcf7 aa21121
⇄specificity => string (22) "Recognizes human HHIP."
$value[4]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[4]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[4]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[4]['_source']['app_notes']
⇄⧉testing_protocols => string (1036) "WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP e...
$value[4]['_source']['testing_protocols']
WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.||AAA25124_WB7.jpg!!WB (Western Blot)||HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.||AAA25124_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.||AAA25124_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.||AAA25124_IP4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].||AAA25124_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.||AAA25124_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.11kD).||AAA25124_WB.jpg
⇄⧉etc_term1 => string (270) "Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP...
$value[4]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ!!Conjugate||FITC
⇄⧉search_terms => string (1137) "aaa25124 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity ...
$value[4]['_source']['search_terms']
aaa25124 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes hhip elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.11kd aaa25124_wb analysis of expression transfected 293t cell line lane 1 lysate 78.9kd 2 non aaa25124_wb2 immunoperoxidase to formalin fixed embedded heart concentration aaa25124_ihc3 using and magnetic bead immunoblotted rabbit polyclonal aaa25124_ip4 testing data limit for recombinant gst tagged is ~1ng capture aaa25124_td5 hela ne aaa25124_wb6 mcf 7 aaa25124_wb7 hedgehog interacting hip unq5825 pro19644 flj20992 flj90230 36,373 da hhip_human 20143973 np_071920 q96qv1 nm_022475 q6pk09 q8nci7 q9bxk3 q9h1j4 q9h7e7 606178 antibodies sonic shh partial corresponding aa21 121 from tag mw the alone 26kd sequence gdakfgernegsgarrrrclngnppkrlkrrdrrmmsqlellsggemlcggfyprlscclrsdspglgrlenkifsvtnntecgklleeikcalcsphsq conjugate ph7.2 lane1 78.9kd2 mcf7 aa21121
⇄specificity => string (22) "Recognizes human HHIP."
$value[5]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[5]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[5]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[5]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[5]['_source']['app_notes']
⇄⧉testing_protocols => string (1036) "WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP e...
$value[5]['_source']['testing_protocols']
WB (Western Blot)||HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.||AAA25418_WB7.jpg!!WB (Western Blot)||HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.||AAA25418_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.||AAA25418_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.||AAA25418_IP4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].||AAA25418_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.||AAA25418_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.11kD).||AAA25418_WB.jpg
⇄⧉etc_term1 => string (269) "Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP...
$value[5]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ!!Conjugate||HRP
⇄⧉search_terms => string (1132) "aaa25418 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity ...
$value[5]['_source']['search_terms']
aaa25418 mouse human monoclonal igg2b,k 5d11 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes hhip elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.11kd aaa25418_wb analysis of expression transfected 293t cell line lane 1 lysate 78.9kd 2 non aaa25418_wb2 immunoperoxidase to formalin fixed embedded heart concentration aaa25418_ihc3 using and magnetic bead immunoblotted rabbit polyclonal aaa25418_ip4 testing data limit for recombinant gst tagged is ~1ng capture aaa25418_td5 hela ne aaa25418_wb6 mcf 7 aaa25418_wb7 hedgehog interacting hip unq5825 pro19644 flj20992 flj90230 36,373 da hhip_human 20143973 np_071920 q96qv1 nm_022475 q6pk09 q8nci7 q9bxk3 q9h1j4 q9h7e7 606178 antibodies sonic shh partial corresponding aa21 121 from tag mw the alone 26kd sequence gdakfgernegsgarrrrclngnppkrlkrrdrrmmsqlellsggemlcggfyprlscclrsdspglgrlenkifsvtnntecgklleeikcalcsphsq conjugate ph7.2 lane1 78.9kd2 mcf7 aa21121
⇄⧉testing_protocols => string (1613) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Sonic Hedg...
$value[6]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with Sonic Hedgehog Protein antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30131_FCM7.jpg!!ICC (Immunocytochemistry)||ICC staining Sonic Hedgehog Protein in 293 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30131_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Sonic Hedgehog Protein in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30131_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining Sonic Hedgehog Protein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30131_ICC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-Sonic Hedgehog Protein antibody. Counter stained with hematoxylin.||AAA30131_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-Sonic Hedgehog Protein antibody. Counter stained with hematoxylin.||AAA30131_IHC2.jpg!!WB (Western Blot)||Western blot analysis of Sonic Hedgehog Protein on different lysates using anti-Sonic Hedgehog Protein antibody at 1/1, 000 dilution. Positive control: Lane 1: Hela Lane 2: HepG2||AAA30131_WB.jpg
HHG 1 antibody; HHG-1 antibody; HHG1 antibody; HLP 3 antibody; HLP3 antibody; Holoprosencephaly 3 antibody; HPE 3 antibody; HPE3 antibody; MCOPCB5 antibody; shh antibody; SHH_HUMAN antibody; SMMC I antibody; SMMCI antibody; Sonic Hedgehog (Drosophila) homolog antibody; sonic hedgehog homolog (Drosophila) antibody; Sonic hedgehog homolog antibody; Sonic hedgehog protein antibody; Sonic hedgehog protein C-product antibody; TPT antibody; TPTPS antibody
⇄products_gene_name => string (3) "SHH"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (790) "The Drosophila segment polarity gene hedgehog (hh) encodes a precursor prote...
$value[6]['_source']['products_description']
The Drosophila segment polarity gene hedgehog (hh) encodes a precursor protein which undergoes autocleavage to generate amino- and carboxy-terminal peptides. Both proteins are secreted and appear to function in embryonic and imaginal disc patterning. Several vertebrate homologs of Drosophila hh have been identified. These include Sonic hedgehog (Shh) (alternatively designated Vhh-1), Desert hedgehog (Dhh) and Indian hedgehog (Ihh). Each contain amino-terminal signal peptides and apparently function as secreted proteins involved in the mediation of various cell-cell interactions. Shh resembles Drosophila hh in that it is processed to generate an amino-terminal secreted peptide that is retained at or near the cell surface and a carboxy-terminal glycosylated more diffusible peptide.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (257) "Nervous System Diseases||573!!Brain Diseases||319!!Abnormalities, Multiple||...
aaa30131 rabbit human monoclonal sc05 28 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc flow cytometry fc facs 1:1000 1:2000 1:200 1:500 1:50 1:100 analysis of sonic hedgehog protein on different lysates using anti antibody at 000 dilution positive control lane hela 2 hepg2 aaa30131_wb immunohistochemical paraffin embedded liver cancer tissue counter stained with hematoxylin aaa30131_ihc2 kidney aaa30131_ihc3 staining in cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30131_icc4 a549 aaa30131_icc5 293 aaa30131_icc6 cytometric 50 red compared an unlabelled without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30131_fc7 shh c product hhg hhg1 hlp 3 hlp3 holoprosencephaly hpe hpe3 mcopcb5 shh_human smmc i smmci drosophila homolog tpt tptps 462 1cleaved into following chains:sonic n 6094283 q15465.1 q15465 q75mc9 a4d247 gene 611638 total ab type recombinant immunogen conjugation unconjugated sc0528 ph7.41 bsa40 at000 hela2 aaa30131_icc5293 cytometric50 fluor488 tptps462
⇄purity => string (45) "Greater than 97.0% as determined by SDS-PAGE."
$value[7]['_source']['purity']
⇄⧉form => string (150) "Lyophilized from a concentrated (1mg/ml) solution in water containing 10mM N...
$value[7]['_source']['form']
Lyophilized from a concentrated (1mg/ml) solution in water containing 10mM Na2PO4 pH-7.5.<br>Sterile Filtered White lyophilized (freeze-dried) powder.
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (285) "Lyophilized Mouse Sonic HedgeHog although stable at room temperature for 3 w...
$value[7]['_source']['storage_stability']
Lyophilized Mouse Sonic HedgeHog although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Sonic HedgeHog should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
⇄app_tested => string (3) "N/A"
$value[7]['_source']['app_tested']
⇄app_notes => string (3) "N/A"
$value[7]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[7]['_source']['testing_protocols']
⇄etc_term1 => string (3) "N/A"
$value[7]['_source']['etc_term1']
⇄⧉etc_term2 => string (356) "Solubility||It is recommended to reconstitute the lyophilized Sonic Hedgehog...
$value[7]['_source']['etc_term2']
Solubility||It is recommended to reconstitute the lyophilized Sonic Hedgehog in sterile 18M?-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.!!Biological Activity||Determined by the dose-dependent induction of alkaline phosphatase production by C3H/10T1/2 (CCL-226) fibroblasts and is typically 0.48-0.72 ug/ml.
⇄products_price => string (6) "0.0000"
$value[7]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[7]['_source']['products_weight']
⇄products_status => boolean true
$value[7]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[7]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "140"
$value[7]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[7]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[7]['_source']['language_id']
⇄products_name => string (14) "Sonic HedgeHog"
$value[7]['_source']['products_name']
⇄products_name_oem => string (32) "Recombinant Mouse Sonic HedgeHog"
$value[7]['_source']['products_name_oem']
⇄⧉products_name_syn => string (85) "SHH Mouse; Sonic Hedgehog Mouse Recombinant; SHH; HHG-1; HHG1; Sonic hedgeho...
$value[7]['_source']['products_name_syn']
SHH Mouse; Sonic Hedgehog Mouse Recombinant; SHH; HHG-1; HHG1; Sonic hedgehog protein
⇄products_gene_name => string (4) "mSHH"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1737) "<b>Description: </b>Sonic Hedgehog Recombinant Mouse produced in E Coli is a...
$value[7]['_source']['products_description']
<b>Description: </b>Sonic Hedgehog Recombinant Mouse produced in E Coli is a single, non-glycosylated polypeptide chain containing 176 amino acids and having a molecular mass of 19.8 kDa. The Mouse Sonic Hedgehog is 99% homologous to the human gene.Cysteine at position 25 has been substituted with Ile.The Sonic HedgeHog is purified by proprietary chromatographic techniques.<br><br><b>Introduction: </b>Recombinant Mouse Sonic Hedgehog is part of a small group of secreted proteins that are vital for development in both vertebrates and invertebrates. 3 mammalian hedgehog genes (sonic, desert, Indian) share about 60% homology. The Mouse Sonic Hedgehog is 99% homologous to the human gene. Sonic HedgeHog is a protein that is vital in guding the early embryo. It has been associated as the major inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Sonic HedgeHog binds to the patched receptor, which functions in association with smoothened, to activate the transcription of target genes. In the absence of sonic HedgeHog, patched receptor represses the constitutive signaling activity of smoothened. Sonic HedgeHog also regulates another factor, the gli oncogene. Sonic HedgeHog intercellular signal is essential for a various patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Sonic HedgeHog exhibits both floor plate- and motor neuron-inducing activity. Mutations in a long-range Sonic HedgeHog enhancer located in an intron of the limb region 1 gene result in preaxial polydactyly.
⇄⧉search_terms => string (990) "aaa10853 e coli greater than 97.0 as determined by sds page lyophilized from...
$value[7]['_source']['search_terms']
aaa10853 e coli greater than 97.0 as determined by sds page lyophilized from a concentrated 1mg ml solution in water containing 10mm na2po4 ph 7.5 sterile filtered white freeze dried powder miigpgrgfg krrhpkkltp laykqfipnv aektlgasgr yegkitrnse rfkeltpnyn pdiifkdeen tgadrlmtqr ckdklnalai svmnqwpgvk lrvtegwded ghhseeslhy egravditts drdrskygml arlaveagfd wvyyeskahi hcsvkaensv aaksgg active protein sonic hedgehog recombinant mouse shh hhg 1 hhg1 mshh hx dsh hxl3 m100081 9530036o11rik hemimelic extra toes short digits 47,773 da 1cleaved into the following 2 chains:sonic n productalternative name s 19 kda product shh_mouse 21617861 np_033196.1 q62226 nm_009170.3 cytokines and growth factors solubility it is recommended to reconstitute 18m? cm h2o not less 100 ug which can then be further diluted other aqueous solutions biological activity dose dependent induction of alkaline phosphatase production c3h 10t1 ccl 226 fibroblasts typically 0.48 0.72 ph7.5 following2 s19 less100 ccl226
⇄⧉products_description => string (2162) "This is a rabbit polyclonal antibody against SHH. It was validated on Wester...
$value[8]['_source']['products_description']
This is a rabbit polyclonal antibody against SHH. It was validated on Western Blot and immunohistochemistry<br><br>Target Description: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
Polyclonal; RNA Binding Proteins; Neurobiology; Signal Proteins; Membrane Protein; Transcription Regulation; Drugs and Drug Metabolism; Developmental Biology; Neuroscience; Signal Transduction; Disease Related; Immunohistochemistry; Pathways In Cancer; Ce
⇄ncbi_full_name => string (46) "sonic hedgehog protein isoform 1 preproprotein"
⇄⧉search_terms => string (1845) "aaa23516 rabbit predicted reactivity cow dog goat guinea pig horse human mou...
$value[8]['_source']['search_terms']
aaa23516 rabbit predicted reactivity cow dog goat guinea pig horse human mouse rat zebrafish chicken tested polyclonal affinity purified liquid antibody supplied in 1x pbs buffer with 0.09 w v sodium azide and 2 sucrose immunohistochemistry ihc western blot wb sample type embryos primary 1:1000 anti shh secondary 1:500 mbs3249294 hrp conjugated aaa23516_ihc formalin fixed paraffin embedded tissue urinary bladder observed staining plasma membrane cytoplasm concentration 1:100 other working concentrations donkey cy3 1:200 magnification 20x exposure time 0.5 2.0 sec aaa23516_ihc2 glioma cellsprimary dilution 1:200secondary gfpsecondary 1:500color signal descriptions 1 green dapi blue 3 mergegene name shhsubmitted by elias el habr phd post doctoral fellow inserm u894 glial plasticity team psychiatry& neurosciences center st anne hospital ter rue d'alesia 75014 paris aaa23516_ihc3 host target brain 1ug ml aaa23516_wb4 stomach tumor 1.0ug aaa23516_wb5 suggested titration 0.2 ug positive control hepg2 cell lysate aaa23516_wb6 synthetic peptide located within the following region rclllvlvssllvcsglacgpgrgfgkrrhpkkltplaykqfipnvaekt n terminal hhg1 hlp3 hpe3 smmci tpt tptps mcopcb5 sonic hedgehog protein isoform preproprotein signaling molecule shhnc 28kda hhg 1cleaved into chains:sonic product c shh_human 4506939 np_000184 q15465 nm_000193 gene 611638 rna binding proteins neurobiology transcription regulation drugs drug metabolism developmental biology neuroscience transduction disease related pathways cancer ce homology 93 100 immunogen is a directed towards of size 462 amino acids interactions ubc sel1l derl2 derl1 syvn1 hhip ptch2 ptch1 adcyap1 gas1 blocking for catalog mbs3232237 replacement items this may replace item sc 1194 from santa cruz biotechnology and2 time0.5 descriptions1 blue3 titration0.2 homology93 size462
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of m...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse IHH. No significant cross-reactivity or interference between mouse IHH and analogues was observed.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[9]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_name_oem => string (36) "Mouse Indian Hedgehog, IHH ELISA Kit"
$value[9]['_source']['products_name_oem']
⇄⧉products_name_syn => string (97) "Mouse Indian Hedgehog (IHH) ELISA kit; BDA1; HHG2; Indian hedgehog homolog; ...
$value[9]['_source']['products_name_syn']
Mouse Indian Hedgehog (IHH) ELISA kit; BDA1; HHG2; Indian hedgehog homolog; Indian Hedgehog (IHH)
⇄products_gene_name => string (3) "IHH"
$value[9]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[9]['_source']['products_gene_name_syn']
⇄⧉products_description => string (727) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[9]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for IHH has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any IHH present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for IHH is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of IHH bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (641) "aaa15820 mouse this assay has high sensitivity and excellent specificity for...
$value[9]['_source']['search_terms']
aaa15820 mouse this assay has high sensitivity and excellent specificity for detection of ihh no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15820_td elisa kit indian hedgehog bda1 hhg2 homolog protein hhg 2 45,485 da 2cleaved into the following chains:indian n product c ihh_mouse 14149643 np_034674.1 p97812 nm_010544.2 q61724 samples serum plasma tissue homogenates type quantitative sandwich range 3.12 pg ml 200 < 0.78 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml200
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of F...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FLII. No significant cross-reactivity or interference between FLII and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (474) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[10]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition.<br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
⇄⧉etc_term1 => string (169) "Samples||Human tissue homogenates, cell lysates and other biological fluids!...
$value[10]['_source']['etc_term1']
Samples||Human tissue homogenates, cell lysates and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||0.156-10ng/mL!!Sensitivity||< 0.055ng/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FLII were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FLII were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[10]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[10]['_source']['products_weight']
⇄products_status => boolean true
$value[10]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[10]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "2700"
$value[10]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[10]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[10]['_source']['language_id']
⇄products_name => string (27) "Flightless I Homolog (FLII)"
⇄⧉products_description => string (983) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[10]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of FLII in human tissue homogenates, cell lysates and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to FLII. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to FLII. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain FLII, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of FLII in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (611) "aaa23075 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa23075 human this assay has high sensitivity and excellent specificity for detection of flii no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa23075_sc elisa kit flightless i homolog fli flil fli1 partial 143,652 da protein 1 440177 aac03568.1 b4dil0 f5h407 j3qlg3 u80184 genomic dna samples tissue homogenates cell lysates other biological fluids type quantitative sandwich range 0.156 10ng ml < 0.055ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv protein1 an3 tested20
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of P...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of PXDN. No significant cross-reactivity or interference between PXDN and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[12]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[12]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (649) "aaa17602 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa17602 human this assay has high sensitivity and excellent specificity for detection of pxdn no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17602_sc elisa kit peroxidasin homolog p53 responsive gene 2 protein melanoma associated antigen mg50 vascular peroxidase 1 vpo vpo1 pxn prg2 copoa d2s448 d2s448e 80,329 da kiaa0230 pxdn_human 109150416 np_036425.1 q92626 nm_012293.2 q4kmg2 a8qm65 d6w4y0 269400 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 78.125 5000pg ml 46.875pg intra precision cv gene2 peroxidase1
⇄⧉products_description => string (676) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[13]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Human Slit2 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (408) "aaa13152 human no cross reaction with other factors typical testing data sta...
$value[13]['_source']['search_terms']
aaa13152 human no cross reaction with other factors typical testing data standard curve for reference only aaa13152_sc elisa kit slit homolog 2 slit2 protein drosophila 169,887 da k7av78_pantr 410353075 jaa43141.1 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision <= 8 inter 12 homolog2 range10 <=8 inter12
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human Slit2. No significant cross-reactivity or interference between human Slit2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[14]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[14]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[14]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for Slit2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any Slit2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for Slit2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of Slit2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[14]['_source']['products_references']
⇄⧉products_related_diseases => string (227) "Breast Neoplasms||23!!Nervous System Diseases||20!!Lung Neoplasms||16!!Skin ...
Activation Of Rac Pathway||119530!!Axon Guidance Pathway||83065!!Axon Guidance Pathway||476!!Axon Guidance Pathway||105688!!Developmental Biology Pathway||477129!!Glypican 1 Network Pathway||138010!!Inactivation Of Cdc42 And Rac Pathway||119529!!Netrin-1 Signaling Pathway||160999!!Regulation Of Commissural Axon Pathfinding By Slit And Robo Pathway||119528!!Role Of Abl In Robo-Slit Signaling Pathway||119531
⇄⧉search_terms => string (532) "aaa15513 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa15513 human this assay has high sensitivity and excellent specificity for detection of slit2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15513_td elisa kit slit homolog 2 drosophila flj14420 slil3 protein isoform 169,870 da slit2_human 574281850 np_001276064.1 o94813 nm_001289135.1 o95710 q17ru3 q9y5q7 b7zlr5 603746 samples serum plasma tissue homogenates type sandwich range 0.78 ng ml 50 0.195 intra precision within an cv homolog2 ml50
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of D...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of DLK-1. No significant cross-reactivity or interference between DLK-1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[15]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[15]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (230) "Liver Diseases||42!!Nervous System Diseases||33!!Hypertrophy||32!!Disease Mo...
⇄⧉ncbi_pathways => string (304) "Activated NOTCH1 Transmits Signal To The Nucleus Pathway||1269536!!Adipogene...
$value[15]['_source']['ncbi_pathways']
Activated NOTCH1 Transmits Signal To The Nucleus Pathway||1269536!!Adipogenesis Pathway||198832!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Notch Signaling Pathway||169345!!Signal Transduction Pathway||1269379!!Signaling By NOTCH Pathway||1269530!!Signaling By NOTCH1 Pathway||1269535
⇄⧉search_terms => string (617) "aaa17558 human this assay has high sensitivity and excellent specificity for...
$value[15]['_source']['search_terms']
aaa17558 human this assay has high sensitivity and excellent specificity for detection of dlk 1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17558_sc elisa kit protein delta homolog dlk1 fa1 pref1 pref zog pg2 like drosophila fetal antigen pg2delta preadipocyte factor secredeltin isoform preproprotein delta1 33,067 da dlk1_human 74136023 np_003827.3 p80370 nm_003836.6 p15803 q96dw5 176290 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 0.156 10ng ml 0.094ng intra precision cv
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[16]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human ANKH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (488) "aaa22521 human typical testing data standard curve for reference only aaa225...
$value[16]['_source']['search_terms']
aaa22521 human typical testing data standard curve for reference only aaa22521_sc elisa kit progressive ankylosis protein homolog ankh inorganic pyrophosphate transport regulator ank cmdj hank mank ccal2 cppdd 54,241 da kiaa1581 unq241 pro274 ankh_human 16905507 np_473368.1 q9hcj1 nm_054027.4 q9nqw2 b2rca7 b3kmg4 d3dtd4 605145 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision range20
⇄⧉products_description => string (894) "Intended Uses: This sandwich kit is for the accurate quantitative detection ...
$value[17]['_source']['products_description']
Intended Uses: This sandwich kit is for the accurate quantitative detection of human Mothers Against Decapentaplegic Homolog 1 (also known as Smad1) in serum, plasma, cell culture supernates, cell lysates, tissue homogenates.<br><br>Principles of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with human Smad1 antibody. Smad1 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated human Smad1 Antibody is added and binds to Smad1 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated Smad1 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of human Smad1. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.
⇄sp_protein_name => string (39) "Mothers against decapentaplegic homolog"
$value[17]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (92) "SMAD family memberUniRule annotationAutomatic assertion according to rulesiR...
$value[17]['_source']['sp_protein_name_syn']
SMAD family memberUniRule annotationAutomatic assertion according to rulesiRuleBase:RU361195
⇄sp_gene_name => string (5) "SMAD1"
$value[17]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (11) "MAD homolog"
$value[17]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[17]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[17]['_source']['sp_mim']
⇄sp_interactions => string (8) "FLNA||12"
$value[17]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[17]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[17]['_source']['products_viewed']
⇄⧉search_terms => string (454) "aaa11163 human typical testing data standard curve for reference only aaa111...
$value[17]['_source']['search_terms']
aaa11163 human typical testing data standard curve for reference only aaa11163_sc elisa kit mothers against decapentaplegic homolog 1 smad1 52,206 da smad family memberunirule annotationautomatic assertion according to rulesirulebase:ru361195 mad 297595318 adi48174.1 samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 0.5ng ml 150ng sensitivity 0.25ng intra cv<8 inter cv<10 homolog1
⇄⧉products_description => string (827) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[18]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human LASS3 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉ncbi_pathways => string (177) "Metabolism Pathway||1007804!!Metabolism Of Lipids And Lipoproteins Pathway||...
$value[18]['_source']['ncbi_pathways']
Metabolism Pathway||1007804!!Metabolism Of Lipids And Lipoproteins Pathway||1007835!!Sphingolipid De Novo Biosynthesis Pathway||1007916!!Sphingolipid Metabolism Pathway||1007915
⇄⧉search_terms => string (427) "aaa13179 human typical testing data standard curve for reference only aaa131...
$value[18]['_source']['search_terms']
aaa13179 human typical testing data standard curve for reference only aaa13179_sc elisa kit lag1 longevity assurance homolog 3 lass3 1 gene 36,498 da at3g25540 mwl2.19 lag11_arath 18404559 np_566769.1 q9ldf2 nm_113450.5 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 ng ml 1.56 sensitivity up to 0.5 intra precision <= 8 inter 12 homolog3 lass31 range100 to0.5 <=8 inter12
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.01-2ug/mL;<br>Immunohistochemistry: 5-20ug/mL;<br>Immunocytochemistry: 5-20ug/mL;<br>Optimal working dilutions must be determined by end user.
⇄⧉testing_protocols => string (1070) "IHC (Immunohistchemistry)||DAB staining on IHC-P.<br>Samples: Human Tissue||...
$value[19]['_source']['testing_protocols']
IHC (Immunohistchemistry)||DAB staining on IHC-P.<br>Samples: Human Tissue||AAA21011_IHC6.jpg!!WB (Western Blot)||Western Blot;<br>Sample: Human Hela cell lysate;<br>Primary Ab: 1ug/ml Rabbit Anti-Human RAD51 Antibody<br>Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (Catalog:||AAA21011_WB5.jpg!!WB (Western Blot)||Knockout Varification:<br>Lane 1: Wild-type Hela cell lysate;<br>Lane 2: RAD51 knockout Hela cell lysate;<br>Predicted MW: 37,31,26kd<br>Observed MW: 37kd<br>Primary Ab: 1ug/ml Rabbit Anti-Human RAD51 Antibody<br>Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (Western Blot)||Western Blot;<br>Sample: Human Jurkat cell lysate;<br>Primary Ab: 1ug/ml Rabbit Anti-Human RAD51 Antibody<br>Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (Catalog:||AAA21011_WB3.jpg!!WB (Western Blot)||Western Blot:<br>Sample: Recombinant RAD51, Human.||AAA21011_WB2.jpg!!WB (Western Blot)||Western Blot:<br>Sample:<br>Lane 1: Human Hela Cells;<br>Lane 2: Human Jurkat Cells.||AAA21011_WB.jpg
⇄⧉search_terms => string (1294) "aaa21011 rabbit human polyclonal affinity chromatography supplied as solutio...
$value[19]['_source']['search_terms']
aaa21011 rabbit human polyclonal affinity chromatography supplied as solution form in pbs ph7.4 containing 0.02 nan3 50 glycerol the antibody is a raised against rad51 it has been selected for its ability to recognize immunohistochemical staining and western blotting blot wb immunocytochemistry icc immunohistochemistry ihc formalin paraffin elisa eia 1:50 400 fixed frozen section 500 enzyme linked immunosorbent assay 1:100 200 sample lane1 hela cells lane2 jurkat aaa21011_wb recombinant aaa21011_wb2 dab on p samples tissue aaa21011_ihc homolog rad51a reca hsrad51 brcc5 brca1 brca2 complex subunit 5 dna repair protein 1 isoform 2 recombinase fancr mrmv2 hrad51 hst16930 36,780 da 256017143 np_001157741.1 q06609 nm_001164269.1 q6fhx9 q6zna8 q9bv60 b0fxp0 b2r8t6 d13804 mrna knock out validation immunoglobulin type igg conjugate no cross reactivity organism species fragment ala2~asp339 quality control content contains disposed loading buffer usage 10ul per well when 3,3' diaminobenzidine substrate 5ul used enhanced chemilumescent ecl note specifically manufactured positive control.not other purposes 100mm tris ph8.8 sds 200mm nacl glycerol,bpb 0.01 conjugated apc version of this item also available catalog #mbs2084584 nan350 1:50400 section500 1:100200 subunit5 protein1 isoform2
