DNA-directed RNA polymerase II subunit RPB1 (Polr2a) Recombinant Protein | Polr2a recombinant protein

Recombinant Mouse DNA-directed RNA polymerase II subunit RPB1 (Polr2a) , partial

Cat. Num. AAA967530

• Gene Names: Polr2a; Rpb1; 220kDa; Rpo2-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-directed RNA polymerase II subunit RPB1 (Polr2a); Recombinant Mouse DNA-directed RNA polymerase II subunit RPB1 (Polr2a); partial; Polr2a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 16-354. Provide the fragment at the N-terminal.
• Sequence: RTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNL
• Sequence Length: 354

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Polr2a recombinant protein

This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.

NCBI and Uniprot Product Information

• NCBI GI #: 597517934
• NCBI GeneID: 20020
• NCBI Accession #: NP_001277997.1
• NCBI GenBank Nucleotide #: NM_001291068.1
• UniProt Accession #: P08775; Q5F298
• Molecular Weight: 217,176 Da
• NCBI Official Full Name: DNA-directed RNA polymerase II subunit RPB1
• NCBI Official Synonym Full Names: polymerase (RNA) II (DNA directed) polypeptide A
• NCBI Official Symbol: Polr2a
• NCBI Official Synonym Symbols: Rpb1; 220kDa; Rpo2-1
• NCBI Protein Information: DNA-directed RNA polymerase II subunit RPB1
• UniProt Protein Name: DNA-directed RNA polymerase II subunit RPB1
• UniProt Gene Name: Polr2a
• UniProt Synonym Gene Names: Rpii215; Rpo2-1; RNA polymerase II subunit B1

Uniprot Description

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates (). Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing (). Regulation of gene expression levels depends on the balance between methylation and acetylation levels of tha CTD-lysines (PubMed:26687004). Initiation or early elongation steps of transcription of growth-factors-induced immediate early genes are regulated by the acetylation status of the CTD (PubMed:24207025). Methylation and dimethylation have a repressive effect on target genes expression (PubMed:26687004).