DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Recombinant Protein | POLR1C recombinant protein
Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C)
Gene Names
POLR1C; AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C); Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C); POLR1C recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-346, Full length protein
Sequence
AASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Sequence Length
345
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,647 Da
NCBI Official Full Name
DNA-directed RNA polymerases I and III subunit RPAC1 isoform 2
NCBI Official Synonym Full Names
RNA polymerase I and III subunit C
NCBI Official Symbol
POLR1C
NCBI Official Synonym Symbols
AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
NCBI Protein Information
DNA-directed RNA polymerases I and III subunit RPAC1
UniProt Protein Name
DNA-directed RNA polymerases I and III subunit RPAC1
Protein Family
UniProt Gene Name
POLR1C
UniProt Synonym Gene Names
POLR1E; DNA-directed RNA polymerase I subunit C; RNA polymerases I and III subunit AC1; RPA40
NCBI Description
The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Description
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft ().
Research Articles on POLR1C
Similar Products
Product Notes
The POLR1C polr1c (Catalog #AAA1232283) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-346, Full length protein. The amino acid sequence is listed below: AASQAVEEMR SRVVLGEFGV RNVHTTDFPG NYSGYDDAWD QDRFEKNFRV DVVHMDENSL EFDMVGIDAA IANAFRRILL AEVPTMAVEK VLVYNNTSIV QDEILAHRLG LIPIHADPRL FEYRNQGDEE GTEIDTLQFR LQVRCTRNPH AAKDSSDPNE LYVNHKVYTR HMTWIPLGNQ ADLFPEGTIR PVHDDILIAQ LRPGQEIDLL MHCVKGIGKD HAKFSPVATA SYRLLPDITL LEPVEGEAAE ELSRCFSPGV IEVQEVQGKK VARVANPRLD TFSREIFRNE KLKKVVRLAR VRDHYIFSVE STGVLPPDVL VSEAIKVLMG KCRRFLDELD AVQMD. It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
