Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Podocalyxin (Podxl) Recombinant Protein | Podxl recombinant protein

Recombinant Rat Podocalyxin (Podxl), partial

Gene Names
Podxl; PC; PCLP-1; podocalyxin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Podocalyxin (Podxl); Recombinant Rat Podocalyxin (Podxl); partial; Podxl recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-386aa, Extracellular domain
Sequence
QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS
Sequence Length
485
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for Podxl recombinant protein
This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+
H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.8 kDa
NCBI Official Full Name
podocalyxin
NCBI Official Synonym Full Names
podocalyxin-like
NCBI Official Symbol
Podxl
NCBI Official Synonym Symbols
PC; PCLP-1; podocalyxin
NCBI Protein Information
podocalyxin
UniProt Protein Name
Podocalyxin
Protein Family
UniProt Gene Name
Podxl
UniProt Synonym Gene Names
Pclp1; PC; PCLP-1

NCBI Description

inhibits cell-cell adhesion; may play a role in maintaining filtration in the glomerular epithelium [RGD, Feb 2006]

Uniprot Description

Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.

Research Articles on Podxl

Similar Products

Product Notes

The Podxl podxl (Catalog #AAA1349313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-386aa, Extracellular domain. The amino acid sequence is listed below: QDNGNKTDTS DITSIDQNQD KPATNQPSNA TPKSSVQPPT PTSISTSSPD PKATQSSNSS VTTTSDSTTD RTSSSTSTVP TTSNSGQTVS SGGKSSDKIT TALPTTLGPV NASSQPTDLN TSTKLPSTPT TNSTASPHQP VSHSEGQHTT VQSSSASVSS SDNTTLLWIL TTSKPTGTSE GTQPIAISTP GITTPVSTPL QPTGSPGGTE SVPTTEEFTH STSSWTPVVS QGPSTPSSTW TSGSYKLKCD PAIKPHEELL ILNLTRDSFC KGSPPNERFL ELLCHSAKAS FKPAEDSCAL ELAPILDNQA VAVKRIVIET KLSPKAVFEL LKDKWDDLTE AGVIDIHLGK EGPPEVNEDR FS. It is sometimes possible for the material contained within the vial of "Podocalyxin (Podxl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.