Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA20962_SDS_PAGE2.jpg SDS-PAGE

Mucin 5 Subtype B Recombinant Protein | MUC5B recombinant protein

Recombinant Mucin 5 Subtype B (MUC5B)

Reactivity
Rattus norvegicus (Rat)
Applications
SDS-Page, Western Blot
Purity
> 95%
Synonyms
Mucin 5 Subtype B; N/A; Recombinant Mucin 5 Subtype B (MUC5B); MUC5B recombinant protein
Ordering
For Research Use Only!
Host
E.coli
Reactivity
Rattus norvegicus (Rat)
Purity/Purification
> 95%
Form/Format
PBS, pH7.4, containing 0.01% SKL, 5% Trehalose.
Concentration
Original Concentration: 80ug/mL (varies by lot)
Sequence
RPCGPMYPASCSPRTQELSDGTLAEGCFCPEGQLLFNSRTDICVSECPCVGPDGLPKLPGEHWISNCQDCVCDLGSVSVQCEPVKCEGQDKPPQCTEAG
Applicable Applications for MUC5B recombinant protein
Positive Control, Immunogen, SDS-PAGE, WB (Western Blot)
Application Notes
(May be suitable for use in other assays to be determined by the end user.)
Source
Prokaryotic expression
Residues
Arg3513~Gly3611
Tags
N-terminal His and GST Tag
Subcellular Location
Secreted
Traits
Freeze-dried powder
Predicted isoelectric point
5.6
Usage
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
Preparation and Storage
Storage:
Avoid repeated freeze/thaw cycles.
Store at 2-8 degree C for one month.
Aliquot and store at -80 degree C for 12 months.

Stability Test:
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

SDS-PAGE

product-image-AAA20962_SDS_PAGE2.jpg SDS-PAGE

Gene Sequencing (Extract)

product-image-AAA20962_SEQUENCE.jpg Gene Sequencing (Extract)

Similar Products

Product Notes

The MUC5B (Catalog #AAA20962) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The Recombinant Mucin 5 Subtype B (MUC5B) reacts with Rattus norvegicus (Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's Mucin 5 Subtype B can be used in a range of immunoassay formats including, but not limited to, Positive Control, Immunogen, SDS-PAGE, WB (Western Blot). (May be suitable for use in other assays to be determined by the end user.). Researchers should empirically determine the suitability of the MUC5B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPCGPMYPAS CSPRTQELSD GTLAEGCFCP EGQLLFNSRT DICVSECPCV GPDGLPKLPG EHWISNCQDC VCDLGSVSVQ CEPVKCEGQD KPPQCTEAG. It is sometimes possible for the material contained within the vial of "Mucin 5 Subtype B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.