Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable hydrolase PNKD (Pnkd) Recombinant Protein | Pnkd recombinant protein

Recombinant Mouse Probable hydrolase PNKD (Pnkd)

Gene Names
Pnkd; MR-1; Brp17; Tahccp2; AI854243; MNCb-5687; 2210013N15Rik; 2810403H05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable hydrolase PNKD (Pnkd); Recombinant Mouse Probable hydrolase PNKD (Pnkd); Pnkd recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-385, full length protein
Sequence
MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKDMHKSK
Sequence Length
385
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,982 Da
NCBI Official Full Name
probable hydrolase PNKD isoform 3
NCBI Official Synonym Full Names
paroxysmal nonkinesiogenic dyskinesia
NCBI Official Symbol
Pnkd
NCBI Official Synonym Symbols
MR-1; Brp17; Tahccp2; AI854243; MNCb-5687; 2210013N15Rik; 2810403H05Rik
NCBI Protein Information
probable hydrolase PNKD
UniProt Protein Name
Probable hydrolase PNKD
Protein Family
UniProt Gene Name
Pnkd
UniProt Synonym Gene Names
Brp17; Kiaa1184; Mr1; Tahccp2; MR-1

Uniprot Description

Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.

Research Articles on Pnkd

Similar Products

Product Notes

The Pnkd pnkd (Catalog #AAA1340116) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-385, full length protein. The amino acid sequence is listed below: MAAVVAATAL KGRGARNARV LRGILSGATA NKASQNRTRA LQSHSSPECK EEPEPLSPEL EYIPRKRGKN PMKAVGLAWY SLYTRTWLGY LFYRQQLRRA RNRYPKGHSK TQPRLFNGVK VLPIPVLSDN YSYLIIDTQA GLAVAVDPSD PRAVQASIEK ERVNLVAILC THKHWDHSGG NRDLSRRHRD CRVYGSPQDG IPYLTHPLCH QDVVSVGRLQ IRALATPGHT QGHLVYLLDG EPYKGPSCLF SGDLLFLSGC GRTFEGTAET MLSSLDTVLD LGDDTLLWPG HEYAEENLGF AGVVEPENLA RERKMQWVQR QRMERKSTCP STLGEERAYN PFLRTHCLEL QEALGPGPGP TSDDGCSRAQ LLEELRRLKD MHKSK. It is sometimes possible for the material contained within the vial of "Probable hydrolase PNKD (Pnkd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.