SDS-Page
(Recombinant Human PMP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)
PMP2 recombinant protein
Recombinant Human PMP2 Protein
Gene Names
PMP2; P2; MP2; CMT1G; FABP8; M-FABP
Purity
>95% by SDS-PAGE.
Synonyms
PMP2; Recombinant Human PMP2 Protein; Myelin P2 Protein; Peripheral Myelin Protein 2; PMP2 recombinant protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Sequence
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Sequence Length
132
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human PMP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)
SDS-Page
(Recombinant Human PMP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)
Related Product Information for PMP2 recombinant protein
Description: Recombinant Human PMP2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val132) of human PMP2 (Accession #P02689) fused with a 6xHis tag at the N-terminus.
Background: This protein localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
Background: This protein localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
Product Categories/Family for PMP2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myelin P2 protein isoform 1
NCBI Official Synonym Full Names
peripheral myelin protein 2
NCBI Official Symbol
PMP2
NCBI Official Synonym Symbols
P2; MP2; CMT1G; FABP8; M-FABP
NCBI Protein Information
myelin P2 protein
UniProt Protein Name
Myelin P2 protein
Protein Family
UniProt Gene Name
PMP2
UniProt Entry Name
MYP2_HUMAN
NCBI Description
The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017]
Uniprot Description
PMP2: May play a role in lipid transport protein in Schwann cells. May bind cholesterol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Chromosomal Location of Human Ortholog: 8q21.3-q22.1
Cellular Component: cytoplasm
Molecular Function: transporter activity; cholesterol binding; fatty acid binding
Biological Process: transport
Research Articles on PMP2
1. Peripheral myelin protein 2 - a novel cluster of mutations causing Charcot-Marie-Tooth neuropathy.
Similar Products
Product Notes
The PMP2 pmp2 (Catalog #AAA9141901) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSNKFLGTWK LVSSENFDDY MKALGVGLAT RKLGNLAKPT VIISKKGDII TIRTESTFKN TEISFKLGQE FEETTADNRK TKSIVTLQRG SLNQVQRWDG KETTIKRKLV NGKMVAECKM KGVVCTRIYE KV. It is sometimes possible for the material contained within the vial of "PMP2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
