Mitogen-activated protein kinase pmk-1 (pmk-1) Recombinant Protein | pmk-1 recombinant protein

Recombinant Caenorhabditis elegans Mitogen-activated protein kinase pmk-1 (pmk-1)

Cat. Num. AAA1297900

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitogen-activated protein kinase pmk-1 (pmk-1); Recombinant Caenorhabditis elegans Mitogen-activated protein kinase pmk-1 (pmk-1); pmk-1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-377, Full length
• Sequence: MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQKNVAFADEEEDEEKMES
• Sequence Length: 377

• Species: Caenorhabditis elegans
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 17541722
• NCBI GeneID: 191743
• NCBI Accession #: NP_501365.1
• NCBI GenBank Nucleotide #: NM_068964.3
• UniProt Accession #: Q17446
• Molecular Weight: 43,919 Da
• NCBI Official Full Name: Mitogen-activated protein kinase pmk-1
• NCBI Official Symbol: pmk-1
• NCBI Protein Information: Mitogen-activated protein kinase pmk-1
• UniProt Protein Name: Mitogen-activated protein kinase pmk-1
• Protein Family: Mitogen-activated protein kinase
• UniProt Gene Name: pmk-1

Uniprot Description

Serine/threonine kinase which responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Phosphorylates snk-1 which probably regulates skn-1 nuclear translocation in response to oxidative stress (PubMed:16166371). Probably by activating skn-1, involved in the up-regulation of gcs-1 and glutathione-S-transferase gst-4 expression upon bacteria infection (PubMed:22216003). Up-regulates expression of gcs-1 in intestinal cells upon arsenite treatment (PubMed:16166371). Functions downstream of the MAPKK sek-1 and the MAPKKK nsy-1 as the MAP kinase which regulates pathogen resistance and responses to oxidative stress (PubMed:11703092, PubMed:12142542, PubMed:18394898, PubMed:16166371). Required for expression of antimicrobial peptide nlp-29 in response to fungal infection or physical injury (PubMed:18394898). Involved in resistance to the nematotoxic C.cinerea galectin Cgl2 (PubMed:20062796). May play a redundant role with other MAP kinases in susceptibility to anoxia, downstream of tir-1/nsy-1 (PubMed:21212236). Phosphorylates transcription factor rnt-1 during oxidative stress which results in rnt-1 stabilization in the intestine (PubMed:22308034). Probably downstream of nsy-1 and sek-1, involved in germline apoptosis induced by heavy metals, such as Cu2+ (PubMed:19497412).