Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid phosphate phosphatase-related protein type 1 (Lppr1) Recombinant Protein | Lppr1 recombinant protein

Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1)

Gene Names
Plppr1; Lppr1; PRG-3; mKIAA4247; E130309F12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid phosphate phosphatase-related protein type 1 (Lppr1); Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1); Lppr1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-325aa; full length protein
Sequence
MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPL LRRIIRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHQQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFRGTQGSPSKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Lppr1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,746 Da
NCBI Official Full Name
phospholipid phosphatase-related protein type 1
NCBI Official Synonym Full Names
phospholipid phosphatase related 1
NCBI Official Symbol
Plppr1
NCBI Official Synonym Symbols
Lppr1; PRG-3; mKIAA4247; E130309F12Rik
NCBI Protein Information
phospholipid phosphatase-related protein type 1
UniProt Protein Name
Phospholipid phosphatase-related protein type 1
UniProt Gene Name
Plppr1
UniProt Synonym Gene Names
PRG-3
UniProt Entry Name
PLPR1_MOUSE

Uniprot Description

PRG-3: a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: integral to membrane; integral to plasma membrane; membrane

Molecular Function: lipid phosphatase activity

Biological Process: nervous system development; phospholipid dephosphorylation; phospholipid metabolic process; signal transduction

Research Articles on Lppr1

Similar Products

Product Notes

The Lppr1 plppr1 (Catalog #AAA7019053) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-325aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Lppr1 plppr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAVENNTQRS YSIIPCFIFV ELVIMAGTVL LAYYFECTDT FQVHIQGFFC QDGDLMKPYP GTEEESFISP LVLYCVLAAT PTAIIFIGEI SMYFIKSTRE SLIAEEKMIL TGDCCYLSPL LRRIIRFIGV FAFGLFATDI FVNAGQVVTG HLTPYFLTVC QPNYTSTDCR AHQQFINNGN ICTGDLEVIE KARRSFPSKH AALSIYSALY ATMYITSTIK TKSSRLAKPV LCLGTLCTAF LTGLNRVSEY RNHCSDVIAG FILGTAVALF LGMCVVHNFR GTQGSPSKPK PEDPRGVPLM AFPRIESPLE TLSAQNHSAS MTEVT. It is sometimes possible for the material contained within the vial of "Lipid phosphate phosphatase-related protein type 1 (Lppr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.