Myelin proteolipid protein (PLP1) Recombinant Protein | PLP1 recombinant protein
Recombinant Dog Myelin proteolipid protein (PLP1)
Gene Names
PLP1; PLP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myelin proteolipid protein (PLP1); Recombinant Dog Myelin proteolipid protein (PLP1); Recombinant Myelin proteolipid protein (PLP1); Myelin proteolipid protein; PLP; Lipophilin; PLP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
179-238. Partial, provide one of the complete extracellular domain.
Sequence
NTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFH
Sequence Length
238
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,091 Da
NCBI Official Full Name
myelin proteolipid protein
NCBI Official Symbol
PLP1
NCBI Official Synonym Symbols
PLP
NCBI Protein Information
myelin proteolipid protein; lipophilin; proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated)
UniProt Protein Name
Myelin proteolipid protein
Protein Family
UniProt Gene Name
PLP1
UniProt Synonym Gene Names
PLP; PLP
UniProt Entry Name
MYPR_CANFA
Uniprot Description
Function: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Subcellular location: Membrane; Multi-pass membrane protein.
Involvement in disease: Note=Defects in PLP1 are the cause of 'shaking pup' disease; a dismyelinating disease.
Sequence similarities: Belongs to the myelin proteolipid protein family.
Similar Products
Product Notes
The PLP1 plp1 (Catalog #AAA948876) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 179-238. Partial, provide one of the complete extracellular domain. The amino acid sequence is listed below: NTWTTCQSIA FPSKTSASIG SLCADARMYG VLPWNAFPGK VCGSNLLSIC KTAEFQMTFH. It is sometimes possible for the material contained within the vial of "Myelin proteolipid protein (PLP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
