Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Myelin proteolipid protein (Plp1) Recombinant Protein | Plp1 recombinant protein

Recombinant Mouse Myelin proteolipid protein (Plp1)

Gene Names
Plp1; jp; Plp; msd; rsh; DM20; jimpy
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myelin proteolipid protein (Plp1); Recombinant Mouse Myelin proteolipid protein (Plp1); Plp1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-277. Full Length of Mature Protein
Sequence
GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Plp1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,274 Da
NCBI Official Full Name
myelin proteolipid protein isoform 2
NCBI Official Synonym Full Names
proteolipid protein (myelin) 1
NCBI Official Symbol
Plp1
NCBI Official Synonym Symbols
jp; Plp; msd; rsh; DM20; jimpy
NCBI Protein Information
myelin proteolipid protein
UniProt Protein Name
Myelin proteolipid protein
Protein Family
UniProt Gene Name
Plp1
UniProt Synonym Gene Names
Plp; PLP
UniProt Entry Name
MYPR_MOUSE

Uniprot Description

PLP1: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. Defects in PLP1 are the cause of leukodystrophy hypomyelinating type 1 (HLD1); also known as Pelizaeus-Merzbacher disease. HLD1 is an X-linked recessive dysmyelinating disorder of the central nervous system in which myelin is not formed properly. It is characterized clinically by nystagmus, spastic quadriplegia, ataxia, and developmental delay. Defects in PLP1 are the cause of spastic paraplegia X- linked type 2 (SPG2). SPG2 is characterized by spastic gait and hyperreflexia. In some patients, complicating features include nystagmus, dysarthria, sensory disturbance, mental retardation, optic atrophy. Belongs to the myelin proteolipid protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell surface; Membrane protein, integral

Cellular Component: integral to membrane; membrane; myelin sheath; plasma membrane

Molecular Function: protein binding; structural constituent of myelin sheath; structural molecule activity

Biological Process: astrocyte development; axon ensheathment; cell maturation; glial cell differentiation; inflammatory response; integrin-mediated signaling pathway; long-chain fatty acid biosynthetic process; myelination; myelination in the central nervous system

Research Articles on Plp1

Similar Products

Product Notes

The Plp1 plp1 (Catalog #AAA7026293) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-277. Full Length of Mature Protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Plp1 plp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GLLECCARCL VGAPFASLVA TGLCFFGVAL FCGCGHEALT GTEKLIETYF SKNYQDYEYL INVIHAFQYV IYGTASFFFL YGALLLAEGF YTTGAVRQIF GDYKTTICGK GLSATVTGGQ KGRGSRGQHQ AHSLERVCHC LGKWLGHPDK FVGITYALTV VWLLVFACSA VPVYIYFNTW TTCQSIAFPS KTSASIGSLC ADARMYGVLP WNAFPGKVCG SNLLSICKTA EFQMTFHLFI AAFVGAAATL VSLLTFMIAA TYNFAVLKLM GRGTKF . It is sometimes possible for the material contained within the vial of "Myelin proteolipid protein (Plp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.