Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Plasminogen receptor (KT) Recombinant Protein | Plgrkt recombinant protein

Recombinant Rat Plasminogen receptor (KT)

Gene Names
Plgrkt; Plg-R(KT); RGD1306839
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plasminogen receptor (KT); Recombinant Rat Plasminogen receptor (KT); Recombinant Plasminogen receptor (KT); Plg-R(KT); Plgrkt recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147
Sequence
MGFIFSKSMNENMKNQQEFMVMHARLQLERQLIMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLAAGAIKRKKPAFLIPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTKLELPKGLITFESLEKARREQSKFFSDK
Sequence Length
147
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,312 Da
NCBI Official Full Name
plasminogen receptor (KT)
NCBI Official Synonym Full Names
plasminogen receptor, C-terminal lysine transmembrane protein
NCBI Official Symbol
Plgrkt
NCBI Official Synonym Symbols
Plg-R(KT); RGD1306839
NCBI Protein Information
plasminogen receptor (KT); plasminogen receptor (KT)
UniProt Protein Name
Plasminogen receptor (KT)
Protein Family
UniProt Gene Name
Plgrkt
UniProt Synonym Gene Names
Plg-R(KT)
UniProt Entry Name
PLRKT_RAT

Uniprot Description

Function: Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9

By similarity. Ref.3

Subunit structure: Interacts with PLAT

By similarity. Interacts with PLAUR. Ref.3

Subcellular location: Cell membrane; Multi-pass membrane protein. Note: Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/PLAUR

By similarity. Ref.3

Tissue specificity: Expressed in adrenal medulla (pheochromocytoma). Ref.3

Similar Products

Product Notes

The Plgrkt plgrkt (Catalog #AAA1142402) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147. The amino acid sequence is listed below: MGFIFSKSMN ENMKNQQEFM VMHARLQLER QLIMQNEMRE RQMAMQIAWS REFLKYFGTF FGIATISLAA GAIKRKKPAF LIPIVPLSFI FTYQYDLGYG TLLQRMKSEA EDILETEKTK LELPKGLITF ESLEKARREQ SKFFSDK. It is sometimes possible for the material contained within the vial of "Plasminogen receptor (KT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.