Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Urokinase plasminogen activator surface receptor Recombinant Protein | PLAUR recombinant protein

Recombinant Human Urokinase plasminogen activator surface receptor (PLAUR)

Gene Names
PLAUR; CD87; UPAR; URKR; U-PAR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urokinase plasminogen activator surface receptor; Recombinant Human Urokinase plasminogen activator surface receptor (PLAUR); Monocyte activation antigen Mo3; CD87; PLAUR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-305aa; Full Length
Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
Sequence Length
290
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PLAUR recombinant protein
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Product Categories/Family for PLAUR recombinant protein
References
Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis.Roldan A.L., Cubellis M.V., Masucci M.T., Behrendt N., Lund L.R., Danoe K., Appella E., Blasi F.EMBO J. 9:467-474(1990)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58.5 kDa
NCBI Official Full Name
urokinase plasminogen activator surface receptor isoform 2
NCBI Official Synonym Full Names
plasminogen activator, urokinase receptor
NCBI Official Symbol
PLAUR
NCBI Official Synonym Symbols
CD87; UPAR; URKR; U-PAR
NCBI Protein Information
urokinase plasminogen activator surface receptor
UniProt Protein Name
Urokinase plasminogen activator surface receptor
UniProt Gene Name
PLAUR
UniProt Synonym Gene Names
MO3; UPAR; U-PAR; uPAR
UniProt Entry Name
UPAR_HUMAN

NCBI Description

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008]

Uniprot Description

uPAR: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. Monomer (Probable). Interacts with MRC2. Interacts (via the UPAR/Ly6 domains) with SRPX2. Expressed in neurons of the rolandic area of the brain. Expressed in the brain. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Receptor, misc.; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: endoplasmic reticulum lumen; endoplasmic reticulum membrane; extrinsic to membrane; focal adhesion; integral to membrane; integral to plasma membrane; plasma membrane

Molecular Function: enzyme binding; protein binding; protein domain specific binding; receptor activity; receptor binding; U-plasminogen activator receptor activity

Biological Process: attachment of GPI anchor to protein; blood coagulation; C-terminal protein lipidation; cell motility; cellular protein metabolic process; chemotaxis; fibrinolysis; negative regulation of apoptosis; positive regulation of DNA binding; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of protein amino acid phosphorylation; post-translational protein modification; regulation of proteolysis; signal transduction

Research Articles on PLAUR

Similar Products

Product Notes

The PLAUR plaur (Catalog #AAA952043) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-305aa; Full Length. The amino acid sequence is listed below: LRCMQCKTNG DCRVEECALG QDLCRTTIVR LWEEGEELEL VEKSCTHSEK TNRTLSYRTG LKITSLTEVV CGLDLCNQGN SGRAVTYSRS RYLECISCGS SDMSCERGRH QSLQCRSPEE QCLDVVTHWI QEGEEGRPKD DRHLRGCGYL PGCPGSNGFH NNDTFHFLKC CNTTKCNEGP ILELENLPQN GRQCYSCKGN STHGCSSEET FLIDCRGPMN QCLVATGTHE PKNQSYMVRG CATASMCQHA HLGDAFSMNH IDVSCCTKSG CNHPDLDVQY RSG. It is sometimes possible for the material contained within the vial of "Urokinase plasminogen activator surface receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.