Transcription factor PIF5 (PIF5) Recombinant Protein | PIF5 recombinant protein

Recombinant Arabidopsis thaliana Transcription factor PIF5 (PIF5)

Cat. Num. AAA1479175

• Gene Names: PIL6; phytochrome interacting factor 3-like 6; PHYTOCHROME-INTERACTING FACTOR 5; PIF5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription factor PIF5 (PIF5); Recombinant Arabidopsis thaliana Transcription factor PIF5 (PIF5); PIF5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-444, Full length protein
• Sequence: MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG
• Sequence Length: 444

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 79315658
• NCBI GeneID: 825075
• NCBI Accession #: NP_001030889.1
• NCBI GenBank Nucleotide #: NM_001035812.2
• UniProt Accession #: Q84LH8; Q8RXG4; Q8S3D7; Q9LYT0
• Molecular Weight: 34,233 Da
• NCBI Official Full Name: phytochrome interacting factor 3-like 6
• NCBI Official Symbol: PIL6
• NCBI Official Synonym Symbols: phytochrome interacting factor 3-like 6; PHYTOCHROME-INTERACTING FACTOR 5; PIF5
• NCBI Protein Information: phytochrome interacting factor 3-like 6
• UniProt Protein Name: Transcription factor PIF5
• Protein Family: Transcription factor
• UniProt Gene Name: PIF5
• UniProt Synonym Gene Names: BHLH65; EN103; PIL6; AtbHLH65; bHLH 65

NCBI Description

Encodes a novel Myc-related bHLH transcription factor, which physically associated with APRR1/TOC1 and is a member of PIF3 transcription factor family. Involved in shade avoidance. Functions as negative regulator of PhyB. Protein levels are modulated by phytochrome B.

Uniprot Description

Transcription factor acting negatively in the phytochrome B signaling pathway to promote the shade-avoidance response. Regulates PHYB abundance at the post-transcriptional level, possibly via the ubiquitin-proteasome pathway. Promotes ethylene activity in the dark. May regulate the expression of a subset of genes by binding to the G-box motif. Might be involved in the integration of light-signals to control both circadian and photomorphogenic processes. Activated by CRY1 and CRY2 in response to low blue light (LBL) by direct binding at chromatin on E-box variant 5'-CA[CT]GTG-3' to stimulate specific gene expression to adapt global physiology (e.g. hypocotyl elongation in low blue light) (PubMed:26724867).