Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription factor PIF5 (PIF5) Recombinant Protein | PIF5 recombinant protein

Recombinant Arabidopsis thaliana Transcription factor PIF5 (PIF5)

Gene Names
PIL6; phytochrome interacting factor 3-like 6; PHYTOCHROME-INTERACTING FACTOR 5; PIF5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor PIF5 (PIF5); Recombinant Arabidopsis thaliana Transcription factor PIF5 (PIF5); PIF5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-444, Full length protein
Sequence
MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG
Sequence Length
444
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,233 Da
NCBI Official Full Name
phytochrome interacting factor 3-like 6
NCBI Official Symbol
PIL6
NCBI Official Synonym Symbols
phytochrome interacting factor 3-like 6; PHYTOCHROME-INTERACTING FACTOR 5; PIF5
NCBI Protein Information
phytochrome interacting factor 3-like 6
UniProt Protein Name
Transcription factor PIF5
Protein Family
UniProt Gene Name
PIF5
UniProt Synonym Gene Names
BHLH65; EN103; PIL6; AtbHLH65; bHLH 65

NCBI Description

Encodes a novel Myc-related bHLH transcription factor, which physically associated with APRR1/TOC1 and is a member of PIF3 transcription factor family. Involved in shade avoidance. Functions as negative regulator of PhyB. Protein levels are modulated by phytochrome B.

Uniprot Description

Transcription factor acting negatively in the phytochrome B signaling pathway to promote the shade-avoidance response. Regulates PHYB abundance at the post-transcriptional level, possibly via the ubiquitin-proteasome pathway. Promotes ethylene activity in the dark. May regulate the expression of a subset of genes by binding to the G-box motif. Might be involved in the integration of light-signals to control both circadian and photomorphogenic processes. Activated by CRY1 and CRY2 in response to low blue light (LBL) by direct binding at chromatin on E-box variant 5'-CA[CT]GTG-3' to stimulate specific gene expression to adapt global physiology (e.g. hypocotyl elongation in low blue light) (PubMed:26724867).

Research Articles on PIF5

Similar Products

Product Notes

The PIF5 pif5 (Catalog #AAA1479175) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-444, Full length protein. The amino acid sequence is listed below: MEQVFADWNF EDNFHMSTNK RSIRPEDELV ELLWRDGQVV LQSQARREPS VQVQTHKQET LRKPNNIFLD NQETVQKPNY AALDDQETVS WIQYPPDDVI DPFESEFSSH FFSSIDHLGG PEKPRTIEET VKHEAQAMAP PKFRSSVITV GPSHCGSNQS TNIHQATTLP VSMSDRSKNV EERLDTSSGG SSGCSYGRNN KETVSGTSVT IDRKRKHVMD ADQESVSQSD IGLTSTDDQT MGNKSSQRSG STRRSRAAEV HNLSERRRRD RINERMKALQ ELIPHCSRTD KASILDEAID YLKSLQMQLQ VMWMGSGMAA AAAAAASPMM FPGVQSSPYI NQMAMQSQMQ LSQFPVMNRS APQNHPGLVC QNPVQLQLQA QNQILSEQLA RYMGGIPQMP PAGNQMQTVQ QQPADMLGFG SPAGPQSQLS APATTDSLHM GKIG. It is sometimes possible for the material contained within the vial of "Transcription factor PIF5 (PIF5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.