Transcription factor PIF4 (PIF4) Recombinant Protein | PIF4 recombinant protein
Recombinant Arabidopsis thaliana Transcription factor PIF4 (PIF4)
Gene Names
PIF4; AtPIF4; MFL8.13; MFL8_13; phytochrome interacting factor 4; SRL2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor PIF4 (PIF4); Recombinant Arabidopsis thaliana Transcription factor PIF4 (PIF4); PIF4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-430, Full length protein
Sequence
MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPMEMLRFSSPAGQQSQQPSSVPTKTTDGSRLDH
Sequence Length
430
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,647 Da
NCBI Official Full Name
phytochrome interacting factor 4
NCBI Official Symbol
PIF4
NCBI Official Synonym Symbols
AtPIF4; MFL8.13; MFL8_13; phytochrome interacting factor 4; SRL2
NCBI Protein Information
phytochrome interacting factor 4
UniProt Protein Name
Transcription factor PIF4
Protein Family
UniProt Gene Name
PIF4
UniProt Synonym Gene Names
BHLH9; EN102; SRL2; AtbHLH9; bHLH 9
NCBI Description
Isolated as a semidominant mutation defective in red -light responses. Encodes a nuclear localized bHLH protein that interacts with active PhyB protein. Negatively regulates phyB mediated red light responses. Involved in shade avoidance response. Protein abundance is negatively regulated by PhyB.
Uniprot Description
Transcription factor acting negatively in the phytochrome B signaling pathway. May regulate the expression of a subset of genes involved in cell expansion by binding to the G-box motif (). Activated by CRY1 and CRY2 in response to low blue light (LBL) by direct binding at chromatin on E-box variant 5'-CA[CT]GTG-3' to stimulate specific gene expression to adapt global physiology (e.g. hypocotyl elongation in low blue light) (PubMed:26724867).
Research Articles on PIF4
Similar Products
Product Notes
The PIF4 pif4 (Catalog #AAA1483468) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-430, Full length protein. The amino acid sequence is listed below: MEHQGWSFEE NYSLSTNRRS IRPQDELVEL LWRDGQVVLQ SQTHREQTQT QKQDHHEEAL RSSTFLEDQE TVSWIQYPPD EDPFEPDDFS SHFFSTMDPL QRPTSETVKP KSSPEPPQVM VKPKACPDPP PQVMPPPKFR LTNSSSGIRE TEMEQYSVTT VGPSHCGSNP SQNDLDVSMS HDRSKNIEEK LNPNASSSSG GSSGCSFGKD IKEMASGRCI TTDRKRKRIN HTDESVSLSD AIGNKSNQRS GSNRRSRAAE VHNLSERRRR DRINERMKAL QELIPHCSKT DKASILDEAI DYLKSLQLQL QVMWMGSGMA AAAASAPMMF PGVQPQQFIR QIQSPVQLPR FPVMDQSAIQ NNPGLVCQNP VQNQIISDRF ARYIGGFPHM QAATQMQPME MLRFSSPAGQ QSQQPSSVPT KTTDGSRLDH. It is sometimes possible for the material contained within the vial of "Transcription factor PIF4 (PIF4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
