Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative phosphonates transport system permease protein phnE (phnE) Recombinant Protein | phnE recombinant protein

Recombinant Escherichia coli Putative phosphonates transport system permease protein phnE (phnE)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative phosphonates transport system permease protein phnE (phnE); Recombinant Escherichia coli Putative phosphonates transport system permease protein phnE (phnE); phnE recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-259
Sequence
MQTITIAPPKRSWFSLLSWAVVLAVLVVSWQGAEMAPLTLIKDGGNMATFAADFFPPDFSQWQDYLTEMAVTLQIAVWGTALAVVLSIPFGLMSAENLVPWWVYQPVRRLMDACRAINEMVFAMLFVVAVGLGPFAGVLALFIHTTGVLSKLLSEAVEAIEPGPVEGIRATGANKLEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIGVTLWEAIRGFQFQQTCALMVLIIVTVSLLDFLSQRLRKHFI
Sequence Length
259
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for phnE recombinant protein
phnE

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
28,384 Da
NCBI Official Full Name
Putative phosphonates transport system permease protein PhnE
UniProt Protein Name
Putative phosphonates transport system permease protein PhnE
UniProt Gene Name
phnE
UniProt Entry Name
PHNE_ECOLI

Uniprot Description

Function: Part of the binding-protein-dependent transport system for phosphonates; probably responsible for the translocation of the substrate across the membrane.

Subcellular location: Cell inner membrane; Multi-pass membrane protein Ref.6.

Miscellaneous: The sequence shown is that of strain B.

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family.Contains 1 ABC transmembrane type-1 domain.

Caution: Could be the product of a pseudogene. In strain K12 the phnE gene has an 8-bp insertion, absent from the strain B gene, which causes a frameshift mutation.

Sequence caution: The sequence AAA24341.1 differs from that shown. Reason: Erroneous initiation. The sequence AAA97002.1 differs from that shown. Reason: Frameshift at position 155. The sequence AAA97003.1 differs from that shown. Reason: Frameshift at position 155. The sequence BAA14264.1 differs from that shown. Reason: Frameshift at position 155. The sequence BAA14265.1 differs from that shown. Reason: Frameshift at position 155. The sequence BAE78106.1 differs from that shown. Reason: Frameshift at position 155. The sequence U00096 differs from that shown. Reason: Frameshift at position 155.

Similar Products

Product Notes

The Putative phosphonates transport system permease protein phnE (phnE) phne (Catalog #AAA1080307) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-259. The amino acid sequence is listed below: MQTITIAPPK RSWFSLLSWA VVLAVLVVSW QGAEMAPLTL IKDGGNMATF AADFFPPDFS QWQDYLTEMA VTLQIAVWGT ALAVVLSIPF GLMSAENLVP WWVYQPVRRL MDACRAINEM VFAMLFVVAV GLGPFAGVLA LFIHTTGVLS KLLSEAVEAI EPGPVEGIRA TGANKLEEIL YGVLPQVMPL LISYSLYRFE SNVRSATVVG MVGAGGIGVT LWEAIRGFQF QQTCALMVLI IVTVSLLDFL SQRLRKHFI. It is sometimes possible for the material contained within the vial of "Putative phosphonates transport system permease protein phnE (phnE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.