Raf homolog serine/threonine-protein kinase phl (phl) Recombinant Protein | phl recombinant protein
Recombinant Drosophila melanogaster Raf homolog serine/threonine-protein kinase phl (phl), partial
Gene Names
Raf; 11-29; C110; CG2845; D-raf; D-Raf; D-RAF; D-raf1; DmelCG2845; draf; dRaf; Draf; DRaf; Draf-1; Draf1; DRaf1; EG:BACH48C10.3; l(1)2Fe; l(1)G0475; l(1)ph; l(1)phl; l(1)pole hole; l(1)polehole; l(1)polehole/draf; l(1)raf; lincRNA.937; ph; ph1; phl; Phl; raf;
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Raf homolog serine/threonine-protein kinase phl (phl); Recombinant Drosophila melanogaster Raf homolog serine/threonine-protein kinase phl (phl); partial; phl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
429-690. Partial, provide the Protein kinase Domain
Sequence
ILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENML
Sequence Length
690
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,729 Da
NCBI Official Full Name
Raf oncogene, isoform E
NCBI Official Synonym Full Names
Raf oncogene
NCBI Official Symbol
Raf
NCBI Official Synonym Symbols
11-29; C110; CG2845; D-raf; D-Raf; D-RAF; D-raf1; DmelCG2845; draf; dRaf; Draf; DRaf; Draf-1; Draf1; DRaf1; EG:BACH48C10.3; l(1)2Fe; l(1)G0475; l(1)ph; l(1)phl; l(1)pole hole; l(1)polehole; l(1)polehole/draf; l(1)raf; lincRNA.937; ph; ph1; phl; Phl; raf;
NCBI Protein Information
CG2845 gene product from transcript CG2845-RE
UniProt Protein Name
Raf homolog serine/threonine-protein kinase phl
Protein Family
UniProt Gene Name
phl
UniProt Synonym Gene Names
ph; D-Raf; dRAF-1
Uniprot Description
Serine/threonine kinase required in the early embryo for the formation of terminal structure (PubMed:3135183, PubMed:8423783). Also required during the proliferation of imaginal cells (PubMed:3135183). May act downstream of Ras85D in the tor signal transduction pathway (PubMed:8423783). During larval development, mediates Ptth/tor signaling leading to the production of ecdysone, an hormone required for the initiation of metamorphosis (PubMed:19965758).
Research Articles on phl
Similar Products
Product Notes
The phl phl (Catalog #AAA1164096) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 429-690. Partial, provide the Protein kinase Domain. The amino acid sequence is listed below: ILIGPRIGSG SFGTVYRAHW HGPVAVKTLN VKTPSPAQLQ AFKNEVAMLK KTRHCNILLF MGCVSKPSLA IVTQWCEGSS LYKHVHVSET KFKLNTLIDI GRQVAQGMDY LHAKNIIHRD LKSNNIFLHE DLSVKIGDFG LATAKTRWSG EKQANQPTGS ILWMAPEVIR MQELNPYSFQ SDVYAFGIVM YELLAECLPY GHISNKDQIL FMVGRGLLRP DMSQVRSDAP QALKRLAEDC IKYTPKDRPL FRPLLNMLEN ML . It is sometimes possible for the material contained within the vial of "Raf homolog serine/threonine-protein kinase phl (phl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
