Putative glucuronosyltransferase PGSIP7 (PGSIP7) Recombinant Protein | AT4G16600 recombinant protein
Recombinant Arabidopsis thaliana Putative glucuronosyltransferase PGSIP7 (PGSIP7)
Gene Names
AT4G16600; DL4325W; FCAALL.404
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative glucuronosyltransferase PGSIP7 (PGSIP7); Recombinant Arabidopsis thaliana Putative glucuronosyltransferase PGSIP7 (PGSIP7); Recombinant Putative glucuronosyltransferase PGSIP7 (PGSIP7); Putative glucuronosyltransferase PGSIP7 EC= 2.4.1.-; Glycogenin-like protein 7 Plant glycogenin-like starch initiation protein 7; AT4G16600 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-494
Sequence
MDLQRTLMFSCWVLSLLIIKTTAYNEKQLFQPLETENANAMTAVMERGLKTQRRPEHKNAYATMMYMGTPRDYEFYVATRVLIRSLKSLHVDADIVVIASLDVPINWIHALEEEDGAKVVRVENLENPYKKQTNFDNRFKLSLNKLYAWSLSDYDRVVMLDVDNLFLKNTDELFQCGQFCAVFINPCIFHTGLFVLQPSMEVFRDMLHELEVKRDNPDGADQGFLVSYFSDLLNQPLFRPPPDNRTALKGHFRLPLGYQMDASYYYLKLRWNVPCGPNSVITFPGAVWLKPWYWWSWPVLPLGLSWHHQRRYTISYSAEMPWVLTQAVFYLGIILVTRLARPNMTKLCYRRSDKNLSMIQTAFKFVALLFILSAYIIPFFIIPQTIHPLIGWSLYLTGSFALSTIPINAFLLPILPVITPWLGIFGTLLVMAFPSYPDGVVRALSVFGYAFCCAPFLWVSFVKITSHLQIMIDKEVLFPRLGESGVTSGLSKLY
Sequence Length
494
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,997 Da
NCBI Official Full Name
GT8-glycogenin domain-containing protein
NCBI Official Symbol
AT4G16600
NCBI Official Synonym Symbols
DL4325W; FCAALL.404
NCBI Protein Information
GT8-glycogenin domain-containing protein
UniProt Protein Name
Putative glucuronosyltransferase PGSIP7
UniProt Gene Name
PGSIP7
UniProt Entry Name
GUX7_ARATH
Uniprot Description
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the glycosyltransferase 8 family. Glycogenin subfamily.
Sequence caution: The sequence CAB10435.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAB78702.1 differs from that shown. Reason: Erroneous gene model prediction.
Similar Products
Product Notes
The AT4G16600 pgsip7 (Catalog #AAA1182172) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-494. The amino acid sequence is listed below: MDLQRTLMFS CWVLSLLIIK TTAYNEKQLF QPLETENANA MTAVMERGLK TQRRPEHKNA YATMMYMGTP RDYEFYVATR VLIRSLKSLH VDADIVVIAS LDVPINWIHA LEEEDGAKVV RVENLENPYK KQTNFDNRFK LSLNKLYAWS LSDYDRVVML DVDNLFLKNT DELFQCGQFC AVFINPCIFH TGLFVLQPSM EVFRDMLHEL EVKRDNPDGA DQGFLVSYFS DLLNQPLFRP PPDNRTALKG HFRLPLGYQM DASYYYLKLR WNVPCGPNSV ITFPGAVWLK PWYWWSWPVL PLGLSWHHQR RYTISYSAEM PWVLTQAVFY LGIILVTRLA RPNMTKLCYR RSDKNLSMIQ TAFKFVALLF ILSAYIIPFF IIPQTIHPLI GWSLYLTGSF ALSTIPINAF LLPILPVITP WLGIFGTLLV MAFPSYPDGV VRALSVFGYA FCCAPFLWVS FVKITSHLQI MIDKEVLFPR LGESGVTSGL SKLY. It is sometimes possible for the material contained within the vial of "Putative glucuronosyltransferase PGSIP7 (PGSIP7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
