Progesterone receptor (Pgr) Recombinant Protein | Pgr recombinant protein
Recombinant Mouse Progesterone receptor (Pgr) , partial
Gene Names
Pgr; PR; PR-A; PR-B; NR3C3; BB114106; 9930019P03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Progesterone receptor (Pgr); Recombinant Mouse Progesterone receptor (Pgr); partial; Pgr recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
671-923?Provide the Steroid-binding domain
Sequence
IQLVPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFR NLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKELSFYSLCL TMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIRELIKAIGLR QKGVVPTSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPEMMSEVIAAQLP KILAGMVKPLLFHKK
Sequence Length
923
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pgr recombinant protein
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap. The location of transcription initiation for isoform A has not been clearly determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81,746 Da
NCBI Official Full Name
progesterone receptor
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
Pgr
NCBI Official Synonym Symbols
PR; PR-A; PR-B; NR3C3; BB114106; 9930019P03Rik
NCBI Protein Information
progesterone receptor
UniProt Protein Name
Progesterone receptor
Protein Family
UniProt Gene Name
Pgr
UniProt Synonym Gene Names
Nr3c3; Pr; PR
NCBI Description
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. [provided by RefSeq, Sep 2015]
Uniprot Description
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as transcriptional activator or repressor.
Research Articles on Pgr
Similar Products
Product Notes
The Pgr pgr (Catalog #AAA956906) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 671-923?Provide the Steroid-binding domain. The amino acid sequence is listed below: IQLVPPLINL LMSIEPDVIY AGHDNTKPDT SSSLLTSLNQ LGERQLLSVV KWSKSLPGFR NLHIDDQITL IQYSWMSLMV FGLGWRSYKH VSGQMLYFAP DLILNEQRMK ELSFYSLCL TMWQIPQEFV KLQVTHEEFL CMKVLLLLNT IPLEGLRSQS QFEEMRSSYI RELIKAIGLR QKGVVPTSQR FYQLTKLLDS LHDLVKQLHL YCLNTFIQSR TLAVEFPEMM SEVIAAQLP KILAGMVKPL LFHKK . It is sometimes possible for the material contained within the vial of "Progesterone receptor (Pgr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
