Placenta growth factor Recombinant Protein | PGF recombinant protein

Recombinant Human Placenta growth factor

Cat. Num. AAA948801

• Gene Names: PGF; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Placenta growth factor; Recombinant Human Placenta growth factor; PGF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-170. Full Length of Mature Protein Isoform PlGF-2
• Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PGF recombinant protein

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.

Product Categories/Family for PGF recombinant protein

Cardiovascular

References

Isolation of a human placenta cDNA coding for a protein related to the vascular permeability factor.Maglione D., Guerriero V., Viglietto G., Delli-Bovi P., Persico M.G.Proc. Natl. Acad. Sci. U.S.A. 88:9267-9271(1991) A heparin-binding form of placenta growth factor (PlGF-2) is expressed in human umbilical vein endothelial cells and in placenta.Hauser S.D., Weich H.A.Growth Factors 9:259-268(1993) Two alternative mRNAs coding for the angiogenic factor, placenta growth factor (PlGF) , are transcribed from a single gene of chromosome 14.Maglione D., Guerriero V., Viglietto G., Ferraro M.G., Aprelikova O., Alitalo K., del Vecchio S., Lei K.-J., Chou J.Y., Persico M.G.Oncogene 8:925-931(1993) Placenta growth factor identification and characterization of a novel isoform generated by RNA alternative splicing.Cao Y., Ji W.-R., Qi P., Rosin A., Cao Y.Biochem. Biophys. Res. Commun. 235:493-498(1997) The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003) Placenta growth factor. Potentiation of vascular endothelial growth factor bioactivity, in vitro and in vivo, and high affinity binding to Flt-1 but not to Flk-1/KDR.Park J.E., Chen H.H., Winer J., Houck K.A., Ferrara N.J. Biol. Chem. 269:25646-25654(1994) HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF.Rolny C., Mazzone M., Tugues S., Laoui D., Johansson I., Coulon C., Squadrito M.L., Segura I., Li X., Knevels E., Costa S., Vinckier S., Dresselaer T., Akerud P., De Mol M., Salomaki H., Phillipson M., Wyns S., Larsson E., Buysschaert I., Botling J., Himmelreich U., Van Ginderachter J.A., De Palma M., Dewerchin M., Claesson-Welsh L., Carmeliet P.Cancer Cell 19:31-44(2011) The crystal structure of human placenta growth factor-1 (PlGF-1) , an angiogenic protein, at 2.0 A resolution.Iyer S., Leonidas D.D., Swaminathan G.J., Maglione D., Battisti M., Tucci M., Persico M.G., Acharya K.R.J. Biol. Chem. 276:12153-12161(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 333033785
• NCBI GeneID: 5228
• NCBI Accession #: NP_001193941.1
• NCBI GenBank Nucleotide #: NM_001207012.1
• UniProt Accession #: P49763; Q07101; Q9BV78; Q9Y6S8
• Molecular Weight: 33.3 kDa
• NCBI Official Full Name: placenta growth factor isoform 2
• NCBI Official Synonym Full Names: placental growth factor
• NCBI Official Symbol: PGF
• NCBI Official Synonym Symbols: PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
• NCBI Protein Information: placenta growth factor
• UniProt Protein Name: Placenta growth factor
• Protein Family: Placenta growth factor
• UniProt Gene Name: PGF
• UniProt Synonym Gene Names: PGFL; PLGF; PlGF
• UniProt Entry Name: PLGF_HUMAN

NCBI Description

This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

PGF: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. Belongs to the PDGF/VEGF growth factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: extracellular region; extracellular space; membrane

Molecular Function: growth factor activity; heparin binding; protein binding; protein heterodimerization activity; protein homodimerization activity

Biological Process: cell differentiation; cell-cell signaling; cellular response to hormone stimulus; female pregnancy; organ regeneration; positive regulation of angiogenesis; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of endothelial cell proliferation; response to drug; response to hypoxia; signal transduction; sprouting angiogenesis; ureteric bud branching; vascular endothelial growth factor receptor signaling pathway