Alpha-tubulin N-acetyltransferase (PFI1220w) Recombinant Protein | PFI1220w recombinant protein
Recombinant Plasmodium falciparum Alpha-tubulin N-acetyltransferase (PFI1220w)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-tubulin N-acetyltransferase (PFI1220w); Recombinant Plasmodium falciparum Alpha-tubulin N-acetyltransferase (PFI1220w); PFI1220w recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-186, Full length protein
Sequence
METFNHIDIKKYTREDLLYLRNTNNVLFKMFQKQVDEIACLSSKEQKLCGTLTSINNIINENYTIYCLIHTDGLIGFIKVTINQIGEKNLYLYDKIKLHYGKCTYFYILEKFQKRGLGIKIFNFMLKDNDISAFCLCYDNPSYKLQNFLKKYFSPCVLIKQPNHFVIFSNYFKNVSIKKVYERISN
Sequence Length
186
Species
Plasmodium falciparum (isolate 3D7)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,123 Da
NCBI Official Full Name
conserved Plasmodium protein, unknown function
NCBI Official Symbol
PFI1220w
NCBI Protein Information
conserved Plasmodium protein, unknown function
UniProt Protein Name
Alpha-tubulin N-acetyltransferase
UniProt Gene Name
PFI1220w
UniProt Synonym Gene Names
Alpha-TAT; TAT
Uniprot Description
Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released.
Similar Products
Product Notes
The PFI1220w pfi1220w (Catalog #AAA1157679) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-186, Full length protein. The amino acid sequence is listed below: METFNHIDIK KYTREDLLYL RNTNNVLFKM FQKQVDEIAC LSSKEQKLCG TLTSINNIIN ENYTIYCLIH TDGLIGFIKV TINQIGEKNL YLYDKIKLHY GKCTYFYILE KFQKRGLGIK IFNFMLKDND ISAFCLCYDN PSYKLQNFLK KYFSPCVLIK QPNHFVIFSN YFKNVSIKKV YERISN. It is sometimes possible for the material contained within the vial of "Alpha-tubulin N-acetyltransferase (PFI1220w), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
