p53 apoptosis effector related to PMP-22 (Perp) Recombinant Protein | Perp recombinant protein
Recombinant Mouse p53 apoptosis effector related to PMP-22 (Perp)
Gene Names
Perp; THW; KCP1; PIGPC1; KRTCAP1; 1110017A08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
p53 apoptosis effector related to PMP-22 (Perp); Recombinant Mouse p53 apoptosis effector related to PMP-22 (Perp); Perp recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-193aa; full length protein
Sequence
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGS YDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAI FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL LGAAKPRYFYPPA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Perp recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,567 Da
NCBI Official Full Name
p53 apoptosis effector related to PMP-22
NCBI Official Synonym Full Names
PERP, TP53 apoptosis effector
NCBI Official Symbol
Perp
NCBI Official Synonym Symbols
THW; KCP1; PIGPC1; KRTCAP1; 1110017A08Rik
NCBI Protein Information
p53 apoptosis effector related to PMP-22
UniProt Protein Name
p53 apoptosis effector related to PMP-22
Protein Family
UniProt Gene Name
Perp
UniProt Synonym Gene Names
Krtcap1; KCP-1
UniProt Entry Name
PERP_MOUSE
Uniprot Description
PERP: Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway. Belongs to the TMEM47 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Mitochondrial; Cell adhesion
Cellular Component: cell junction; Golgi apparatus; integral to membrane; integral to plasma membrane; membrane; mitochondrion; plasma membrane
Biological Process: apoptosis; cell adhesion; heterotypic cell-cell adhesion; Notch signaling pathway; positive regulation of proteolysis
Research Articles on Perp
Similar Products
Product Notes
The Perp perp (Catalog #AAA7025489) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-193aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Perp perp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLRCGLACER CRWILPLLLL SAIAFDIIAL AGRGWLQSSN HIQTSSLWWR CFDEGGGSGS YDDGCQSLME YAWGRAAAAT LFCGFIILCI CFILSFFALC GPQMLVFLRV IGGLLALAAI FQIISLVIYP VKYTQTFRLH DNPAVNYIYN WAYGFGWAAT IILIGCSFFF CCLPNYEDDL LGAAKPRYFY PPA. It is sometimes possible for the material contained within the vial of "p53 apoptosis effector related to PMP-22 (Perp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
