Protein pelota (pelo) Recombinant Protein | pelo recombinant protein
Recombinant Drosophila melanogaster Protein pelota (pelo)
Gene Names
pelo; CG3959; DmelCG3959; ms(2)01559
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein pelota (pelo); Recombinant Drosophila melanogaster Protein pelota (pelo); pelo recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-395, Full length protein
Sequence
MKLLGKYVDKGMQGNVTLVPEESEDMWHAYNLIAKGDSVRSTTIRKVQNETATGSSTSSRVRTTLTIAVESIDFDTQACVLRLKGRNIEENQYVKMGAYHTLDLELNRKFELRKPEWDTIALERIEMACDPTQSADVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRKGSVQQHEKGLAKFYEQVMQSILRHVNFDVVKCVLIASPGFVRDQFYDYMFQQAVKMDYKLLLDNKSKFMLVHASSGFKHSLREILQDPAVLAKMSDTKAAGEVKALEQFYMMLQCEPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKEYVNLVESIRDAGGEVKIFSSMHISGEQLAQLTGIAALLRFPMPELEDSDDDDDEDGAAGGVADSDSD
Sequence Length
395
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,212 Da
NCBI Official Full Name
pelota
NCBI Official Synonym Full Names
pelota
NCBI Official Symbol
pelo
NCBI Official Synonym Symbols
CG3959; DmelCG3959; ms(2)01559
NCBI Protein Information
CG3959 gene product from transcript CG3959-RA
UniProt Protein Name
Protein pelota
Protein Family
UniProt Gene Name
pelo
Uniprot Description
Required prior to the first meiotic division for spindle formation and nuclear envelope breakdown during spermatogenesis. It is also required for normal eye patterning and for mitotic divisions in the ovary. Required for ovarian germ line stem cell self-renewal. May play a role in regulating translation. May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity (Potential).
Research Articles on pelo
Similar Products
Product Notes
The pelo pelo (Catalog #AAA1041598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-395, Full length protein. The amino acid sequence is listed below: MKLLGKYVDK GMQGNVTLVP EESEDMWHAY NLIAKGDSVR STTIRKVQNE TATGSSTSSR VRTTLTIAVE SIDFDTQACV LRLKGRNIEE NQYVKMGAYH TLDLELNRKF ELRKPEWDTI ALERIEMACD PTQSADVAAV VMQEGLAHVC LITASMTLVR SKIEVSIPRK RKGSVQQHEK GLAKFYEQVM QSILRHVNFD VVKCVLIASP GFVRDQFYDY MFQQAVKMDY KLLLDNKSKF MLVHASSGFK HSLREILQDP AVLAKMSDTK AAGEVKALEQ FYMMLQCEPA KAFYGKKHVL QAAESQAIET LLISDNLFRC QDVSLRKEYV NLVESIRDAG GEVKIFSSMH ISGEQLAQLT GIAALLRFPM PELEDSDDDD DEDGAAGGVA DSDSD. It is sometimes possible for the material contained within the vial of "Protein pelota (pelo), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
