Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Peflin (Pef1) Recombinant Protein | Pef1 recombinant protein

Recombinant Rat Peflin (Pef1)

Gene Names
Pef1; Peflin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peflin (Pef1); Recombinant Rat Peflin (Pef1); Pef1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-283, full length protein
Sequence
MASYPDGQSYPGAAGQVPGPHPGGYYPGPPHGGGQYGSGFPPGGYGAPAPGGPYGYPSAGGTPSGTPGGPYGGGPPGGPYGGGPPGGPYGQAHPSPYGTQPPGPYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCTRSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML
Sequence Length
283
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,012 Da
NCBI Official Full Name
peflin
NCBI Official Synonym Full Names
penta-EF hand domain containing 1
NCBI Official Symbol
Pef1
NCBI Official Synonym Symbols
Peflin
NCBI Protein Information
peflin
UniProt Protein Name
Peflin
Protein Family
UniProt Gene Name
Pef1

Uniprot Description

Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Its role in the heterodimer formed with PDCD6 is however unclear: some evidences show that PEF1 and PDCD6 work together and promote association between PDCD6 and SEC31 in presence of calcium. Other reports show that PEF1 dissociates from PDCD6 in presence of calcium, and may act as a negative regulator of PDCD6 (). Also acts as a negative regulator of ER-Golgi transport; possibly by inhibiting interaction between PDCD6 and SEC31 (PubMed:27276012).

Research Articles on Pef1

Similar Products

Product Notes

The Pef1 pef1 (Catalog #AAA1347445) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-283, full length protein. The amino acid sequence is listed below: MASYPDGQSY PGAAGQVPGP HPGGYYPGPP HGGGQYGSGF PPGGYGAPAP GGPYGYPSAG GTPSGTPGGP YGGGPPGGPY GGGPPGGPYG QAHPSPYGTQ PPGPYGQGGV PPNVDPEAYS WFQSVDADHS GYISLKELKQ ALVNSNWSSF NDETCLMMIN MFDKTKTGRI DVVGFSALWK FLQQWKNLFQ QYDRDHSGSI SSTELQQALS QMGYNLSPQF TQLLVSRYCT RSAIPAMQLD CFIKVCTQLQ VLTEAFREKD TAVQGNIRLS FEDFVTMTAS RML. It is sometimes possible for the material contained within the vial of "Peflin (Pef1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.