Pyridoxal biosynthesis protein PDX2 (PDX2) Recombinant Protein | PDX2 recombinant protein
Recombinant Arabidopsis thaliana Pyridoxal biosynthesis protein PDX2 (PDX2)
Gene Names
PDX2; ATPDX2; EMB2407; EMBRYO DEFECTIVE 2407; MUF9.1; MUF9_1; pyridoxine biosynthesis 2; PYRIDOXINE BIOSYNTHESIS 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pyridoxal biosynthesis protein PDX2 (PDX2); Recombinant Arabidopsis thaliana Pyridoxal biosynthesis protein PDX2 (PDX2); PDX2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-255, Full length protein
Sequence
MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLFPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEADILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEEDALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKEIEQGASSSSSKTIVSVGETSAGPEPAKPDLPIFQ
Sequence Length
255
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,438 Da
NCBI Official Full Name
pyridoxine biosynthesis 2
NCBI Official Symbol
PDX2
NCBI Official Synonym Symbols
ATPDX2; EMB2407; EMBRYO DEFECTIVE 2407; MUF9.1; MUF9_1; pyridoxine biosynthesis 2; PYRIDOXINE BIOSYNTHESIS 2
NCBI Protein Information
pyridoxine biosynthesis 2
UniProt Protein Name
Probable pyridoxal 5'-phosphate synthase subunit PDX2
Protein Family
UniProt Gene Name
PDX2
UniProt Synonym Gene Names
EMB2407; AtPDX2
NCBI Description
Encodes a protein predicted to function in tandem with PDX1 to form glutamine amidotransferase complex with involved in vitamin B6 biosynthesis. PDX2 is predicted to function as glutaminase within the complex.
Uniprot Description
Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is channeled to the active site of PDX1. Involved in the indirect resistance to singlet oxygen-generating photosensitizers.
Research Articles on PDX2
Similar Products
Product Notes
The PDX2 pdx2 (Catalog #AAA1460310) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-255, Full length protein. The amino acid sequence is listed below: MTVGVLALQG SFNEHIAALR RLGVQGVEIR KADQLLTVSS LIIPGGESTT MAKLAEYHNL FPALREFVKM GKPVWGTCAG LIFLADRAVG QKEGGQELVG GLDCTVHRNF FGSQIQSFEA DILVPQLTSQ EGGPETYRGV FIRAPAVLDV GPDVEVLADY PVPSNKVLYS SSTVQIQEED ALPETKVIVA VKQGNLLATA FHPELTADTR WHSYFIKMTK EIEQGASSSS SKTIVSVGET SAGPEPAKPD LPIFQ. It is sometimes possible for the material contained within the vial of "Pyridoxal biosynthesis protein PDX2 (PDX2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
