Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Programmed cell death protein 5 (PDCD5) Recombinant Protein | PDCD5 recombinant protein

Recombinant Human Programmed cell death protein 5 (PDCD5)

Gene Names
PDCD5; TFAR19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Programmed cell death protein 5 (PDCD5); Recombinant Human Programmed cell death protein 5 (PDCD5); Programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; Protein TFAR19; PDCD5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-125aa; Full Length
Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Sequence Length
124
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for PDCD5 recombinant protein
May function in the process of apoptosis.
Product Categories/Family for PDCD5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.2 kDa
NCBI Official Full Name
programmed cell death protein 5
NCBI Official Synonym Full Names
programmed cell death 5
NCBI Official Symbol
PDCD5
NCBI Official Synonym Symbols
TFAR19
NCBI Protein Information
programmed cell death protein 5; TFAR19 novel apoptosis-related; TF1 cell apoptosis-related gene 19; TF-1 cell apoptosis-related protein 19
UniProt Protein Name
Programmed cell death protein 5
UniProt Gene Name
PDCD5
UniProt Synonym Gene Names
TFAR19; Protein TFAR19
UniProt Entry Name
PDCD5_HUMAN

NCBI Description

This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12 [provided by RefSeq, Dec 2010]

Uniprot Description

PDCD5: May function in the process of apoptosis. Belongs to the PDCD5 family.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 19q13.11

Cellular Component: cytoplasm; nucleus

Molecular Function: heparin binding; protein binding; DNA binding; beta-tubulin binding

Biological Process: negative regulation of cell proliferation; positive regulation of apoptosis; positive regulation of caspase activity

Research Articles on PDCD5

Similar Products

Product Notes

The PDCD5 pdcd5 (Catalog #AAA1185849) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-125aa; Full Length. The amino acid sequence is listed below: MADEELEALR RQRLAELQAK HGDPGDAAQQ EAKHREAEMR NSILAQVLDQ SARARLSNLA LVKPEKTKAV ENYLIQMARY GQLSEKVSEQ GLIEILKKVS QQTEKTTTVK FNRRKVMDSD EDDDY. It is sometimes possible for the material contained within the vial of "Programmed cell death protein 5 (PDCD5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.