Proliferating cell nuclear antigen (Pcna) Recombinant Protein | Pcna recombinant protein

Recombinant Mouse Proliferating cell nuclear antigen (Pcna)

Cat. Num. AAA948560

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proliferating cell nuclear antigen (Pcna); Recombinant Mouse Proliferating cell nuclear antigen (Pcna); Pcna recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-261, Full length protein
• Sequence: MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEAS
• Sequence Length: 261

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Pcna recombinant protein

This protein is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.

NCBI and Uniprot Product Information

• NCBI GI #: 7242171
• NCBI GeneID: 18538
• NCBI Accession #: NP_035175.1
• NCBI GenBank Nucleotide #: NM_011045.2
• UniProt Accession #: P17918
• Molecular Weight: 28,785 Da
• NCBI Official Full Name: proliferating cell nuclear antigen
• NCBI Official Synonym Full Names: proliferating cell nuclear antigen
• NCBI Official Symbol: Pcna
• NCBI Protein Information: proliferating cell nuclear antigen
• UniProt Protein Name: Proliferating cell nuclear antigen
• Protein Family: Proliferating cell nuclear antigen
• UniProt Gene Name: Pcna
• UniProt Synonym Gene Names: PCNA

Uniprot Description

Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion ().