Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pterin-4-alpha-carbinolamine dehydratase Recombinant Protein | PHS recombinant protein

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase

Gene Names
PCBD1; PCD; PHS; DCOH; PCBD
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Pterin-4-alpha-carbinolamine dehydratase; Recombinant Human Pterin-4-alpha-carbinolamine dehydratase; 4-alpha-hydroxy-tetrahydropterin dehydratase; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; DCoH; Dimerization cofactor of HNF1; Phenylalanine hydroxylase-stimulating protein; Pterin carbinolamine dehydratase; PCD; PHS recombinant protein
Ordering
For Research Use Only!
Host
Yeast
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length, 2-104aa
Sequence
MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYN KVHITLSTHECAGLSERDINLASFIEQVAVSMT
Tag Info
His-tag
Target Name
PHS
Description
Recombinant protein
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for PHS recombinant protein
Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kD
NCBI Official Full Name
pterin-4-alpha-carbinolamine dehydratase isoform 1
NCBI Official Synonym Full Names
pterin-4 alpha-carbinolamine dehydratase 1
NCBI Official Symbol
PCBD1
NCBI Official Synonym Symbols
PCD; PHS; DCOH; PCBD
NCBI Protein Information
pterin-4-alpha-carbinolamine dehydratase
UniProt Protein Name
Pterin-4-alpha-carbinolamine dehydratase
UniProt Gene Name
PCBD1
UniProt Synonym Gene Names
DCOH; PCBD; PHS; DCoH; Dimerization cofactor of HNF1; PCD

NCBI Description

This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. A deficiency of this enzyme leads to hyperphenylalaninemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

PCBD1: Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Defects in PCBD1 are the cause of BH4-deficient hyperphenylalaninemia type D (HPABH4D); also known as hyperphenylalaninemia with primapterinuria. HPABH4D is characterized by the excretion of 7-substituted pterins in the urine of affected patients. Belongs to the pterin-4-alpha-carbinolamine dehydratase family.

Protein type: EC 4.2.1.96; Lyase; Oxidoreductase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: cytosol; nucleoplasm; nucleus

Molecular Function: 4-alpha-hydroxytetrahydrobiopterin dehydratase activity; identical protein binding; protein binding

Biological Process: L-phenylalanine catabolic process

Disease: Hyperphenylalaninemia, Bh4-deficient, D

Research Articles on PHS

Similar Products

Product Notes

The PHS pcbd1 (Catalog #AAA9422431) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 2-104aa. The Recombinant Human Pterin-4-alpha-carbinolamine dehydratase reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MAGKAHRLSA EERDQLLPNL RAVGWNELEG RDAIFKQFHF KDFNRAFGFM TRVALQAEKL DHHPEWFNVY N KVHITLS THECAGLSER DINLASFIEQ VAVSMT. It is sometimes possible for the material contained within the vial of "Pterin-4-alpha-carbinolamine dehydratase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.