PRKC apoptosis WT1 regulator protein (PAWR) Recombinant Protein | PAWR recombinant protein

Recombinant Human PRKC apoptosis WT1 regulator protein (PAWR)

Cat. Num. AAA1473166

• Gene Names: PAWR; PAR4; Par-4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: PRKC apoptosis WT1 regulator protein (PAWR); Recombinant Human PRKC apoptosis WT1 regulator protein (PAWR); PAWR recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-340, Full length protein
• Sequence: MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
• Sequence Length: 340

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for PAWR recombinant protein

The tumor suppressor WT1 represses and activates transcription. This protein is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.

NCBI and Uniprot Product Information

• NCBI GI #: 55769533
• NCBI GeneID: 5074
• NCBI Accession #: NP_002574.2
• NCBI GenBank Nucleotide #: NM_002583.3
• UniProt Accession #: Q96IZ0; O75796; Q6FHY9; Q8N700
• Molecular Weight: 36,568 Da
• NCBI Official Full Name: PRKC apoptosis WT1 regulator protein isoform 1
• NCBI Official Synonym Full Names: pro-apoptotic WT1 regulator
• NCBI Official Symbol: PAWR
• NCBI Official Synonym Symbols: PAR4; Par-4
• NCBI Protein Information: PRKC apoptosis WT1 regulator protein
• UniProt Protein Name: PRKC apoptosis WT1 regulator protein
• Protein Family: PRKC apoptosis WT1 regulator protein
• UniProt Gene Name: PAWR
• UniProt Synonym Gene Names: PAR4; Par-4

NCBI Description

This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]

Uniprot Description

Pro-apoptopic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1.