Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Presenilins-associated rhomboid-like protein (Parl) Recombinant Protein | Parl recombinant protein

Recombinant Rat Presenilins-associated rhomboid-like protein, mitochondrial (Parl)

Gene Names
Parl; Psarl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Presenilins-associated rhomboid-like protein (Parl); Recombinant Rat Presenilins-associated rhomboid-like protein; mitochondrial (Parl); Parl recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
51-377aa; full length protein
Sequence
FRKAPRKVEPRRSDTGSSGEAYKRSALIPPLEETVFYPSPYPVRTLLKPFFFTVGFTGCA FGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGNLRKEINKWWNSLSDGQRTVTGI IAANALVFCLWRVPSLHRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSF STSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPSLGASGAIMTVLAAVCTKIP EGRLAIIFLPVFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYITYGHEL IWKNREPLVKIWHEIRTNGPKKGGGSK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Parl recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,619 Da
NCBI Official Full Name
presenilins-associated rhomboid-like protein, mitochondrial
NCBI Official Synonym Full Names
presenilin associated, rhomboid-like
NCBI Official Symbol
Parl
NCBI Official Synonym Symbols
Psarl
NCBI Protein Information
presenilins-associated rhomboid-like protein, mitochondrial
UniProt Protein Name
Presenilins-associated rhomboid-like protein, mitochondrial
UniProt Gene Name
Parl
UniProt Synonym Gene Names
Pbeta
UniProt Entry Name
PARL_RAT

Uniprot Description

PSARL: a mitochondrial intramembrane protease that is associated with insulin resistance and type 2 diabetes. Induced in humans by caloric restriction. Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptotic signals. Promotes changes in mitochondria morphology regulated by phosphorylation of P-beta domain. Induced in humans by caloric restriction. Interacts with PSEN1 and PSEN2. Binds OPA1. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Protease; Mitochondrial; EC 3.4.21.105; Apoptosis; Membrane protein, integral

Cellular Component: integral to membrane; mitochondrial inner membrane; mitochondrion; nucleus

Molecular Function: endopeptidase activity; serine-type endopeptidase activity

Biological Process: protein processing; proteolysis; regulation of proteolysis

Research Articles on Parl

Similar Products

Product Notes

The Parl parl (Catalog #AAA7025378) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 51-377aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Parl parl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FRKAPRKVEP RRSDTGSSGE AYKRSALIPP LEETVFYPSP YPVRTLLKPF FFTVGFTGCA FGSAAIWQYE SLKSRVQSYF DGIKADWLDS IRPQKEGNLR KEINKWWNSL SDGQRTVTGI IAANALVFCL WRVPSLHRTM IRYFTSNPAS KVLCSPMLLS TFSHFSLFHM AANMYVLWSF STSIVNILGQ EQFVAVYLSA GVISNFVSYV CKVATGRYGP SLGASGAIMT VLAAVCTKIP EGRLAIIFLP VFTFTAGNAL KAIIAMDTAG MILGWKFFDH AAHLGGALFG IWYITYGHEL IWKNREPLVK IWHEIRTNGP KKGGGSK. It is sometimes possible for the material contained within the vial of "Presenilins-associated rhomboid-like protein (Parl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.