Progestin and adipoq receptor-like protein 1 (paqr-1) Recombinant Protein | paqr-1 recombinant protein
Recombinant Progestin and adipoq receptor-like protein 1 (paqr-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Progestin and adipoq receptor-like protein 1 (paqr-1); Recombinant Progestin and adipoq receptor-like protein 1 (paqr-1); Progestin and adipoq receptor-like protein 1; paqr-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-423
Sequence
MDPDEVNQALGHYLNDSESGELVVEDSTTVQVTNPEARKTGDKIEVYYSRKTTVVSPTNSDDEEGEFCSDSELLPAQGGHRSRATSFAGRVRAGSDDEMNPKHTVLRYRRKKGGQWREVNAQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGHRPPLPSFAECFKSIWSLHTETGNIWTHLIGCVAFFLLACWFLTRPDNHIQFQEKVVFSFFFAGAVSVSDSRSPSTPSRVIRSTSSRYSANSTIWESRCSLSARLFQPKITYIAMVCVLGIGAIVVSLWDKFSESKYRPVRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAALYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFARLNEQCPVR
Sequence Length
423
Species
Caenorhabditis briggsae
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
48,054 Da
UniProt Protein Name
Progestin and adipoq receptor-like protein 1
Protein Family
UniProt Gene Name
paqr-1
UniProt Entry Name
ADRL_CAEBR
Uniprot Description
Function: Probable receptor, which may be involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation
By similarity. UniProtKB Q94177
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the ADIPOR family.
Similar Products
Product Notes
The Progestin and adipoq receptor-like protein 1 (paqr-1) paqr-1 (Catalog #AAA1250637) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-423. The amino acid sequence is listed below: MDPDEVNQAL GHYLNDSESG ELVVEDSTTV QVTNPEARKT GDKIEVYYSR KTTVVSPTNS DDEEGEFCSD SELLPAQGGH RSRATSFAGR VRAGSDDEMN PKHTVLRYRR KKGGQWREVN AQGTPDKRKD DEDELEVDVK EDRSEQTGIV TKTYEARWKV LKYEHLPEWL QDNEFLRHGH RPPLPSFAEC FKSIWSLHTE TGNIWTHLIG CVAFFLLACW FLTRPDNHIQ FQEKVVFSFF FAGAVSVSDS RSPSTPSRVI RSTSSRYSAN STIWESRCSL SARLFQPKIT YIAMVCVLGI GAIVVSLWDK FSESKYRPVR AAVFVGMGCS GVIPTIHYII TDGVHSLFAD NSFHWLLLMA FLYLLGAALY ATRTPERFFP GKCDIWFQSH QLFHTCVVIA AFVHYYGISE MAFARLNEQC PVR. It is sometimes possible for the material contained within the vial of "Progestin and adipoq receptor-like protein 1 (paqr-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
