Proline-rich P65 protein (p65) Recombinant Protein | p65 recombinant protein

Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Proline-rich P65 protein (p65); Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65); p65 recombinant protein

Ordering
Cat. Num. AAA1189384 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-407, Full length protein

Sequence

MDINKPGWNQSDQQATAYDPNQQQYYGDGSTYYDPDQAVDPNQAYYPDPNTYPDAAAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPNAYVDPNAYQDPNAYVDPNNYTDPNAYYGYGQDGQAYPQDYAQDPNQAYYAYVDPNAYQDPNAYTDPYYVTSTDHNAYYGQVDNVPALEASDLAYEVTPQEQAAEQELFSEPETKVIREIHEFPFEKIRSYFQTDFDSYNSRLTQLKDKLDNAIFSMRKAIDTVKENSANLQIMKQNFERQLKEQQTQRLTSNTDAEKIGAKINQLEERMQRLSRTMESVEWTKKEPRQEQFDPRFVDPRNFNNYVNNTDTMMSMFEKVLMMNLLRSTTPVQPPVQYFTPQPLTASPRPVYEEPISASFRRRGYRGDEFYE

Sequence Length

407

Species

Mycoplasma pneumoniae (strain ATCC 15531 / NBRC 14401 / NCTC 10119 / FH)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

504387840

NCBI Accession #

WP_014574942.1

NCBI GenBank Nucleotide #

WP_014574942.1

UniProt Accession #

E1QC64; P53663; P53664; Q6LAC2; Q6LAC3

Molecular Weight

47,342 Da

NCBI Official Full Name

proline-rich P65 protein

UniProt Protein Name

Proline-rich P65 protein

Protein Family

Proline-rich P65 protein

UniProt Gene Name

p65

Uniprot Description

Enzyme and pathway databasesBioCyc Collection of Pathway/Genome DatabasesMore...BioCyciMPNE722438:G1GM4-353-MONOMER.

Similar Products

Product Notes

The p65 p65 (Catalog #AAA1189384) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-407, Full length protein. The amino acid sequence is listed below: MDINKPGWNQ SDQQATAYDP NQQQYYGDGS TYYDPDQAVD PNQAYYPDPN TYPDAAAYYG YGQDGQAYPQ DYAQDPNQAY YADPNAYQDP NAYTDPNAYV DPNAYQDPNA YVDPNNYTDP NAYYGYGQDG QAYPQDYAQD PNQAYYAYVD PNAYQDPNAY TDPYYVTSTD HNAYYGQVDN VPALEASDLA YEVTPQEQAA EQELFSEPET KVIREIHEFP FEKIRSYFQT DFDSYNSRLT QLKDKLDNAI FSMRKAIDTV KENSANLQIM KQNFERQLKE QQTQRLTSNT DAEKIGAKIN QLEERMQRLS RTMESVEWTK KEPRQEQFDP RFVDPRNFNN YVNNTDTMMS MFEKVLMMNL LRSTTPVQPP VQYFTPQPLT ASPRPVYEEP ISASFRRRGY RGDEFYE. It is sometimes possible for the material contained within the vial of "Proline-rich P65 protein (p65), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...