SDS-PAGE
High affinity transport system protein p37 (p37) Recombinant Protein | p37 recombinant protein
Recombinant Mycoplasma genitalium High affinity transport system protein p37 (p37)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity transport system protein p37 (p37); Recombinant Mycoplasma genitalium High affinity transport system protein p37 (p37); High affinity transport system protein p37; p37 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-368aa; Full Length of Mature Protein
Sequence
CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK
Sequence Length
368
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for p37 recombinant protein
P37 is part of a high-affinity transport system.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.4 kDa
NCBI Official Full Name
phosphonate ABC transporter substrate-binding protein
NCBI Official Symbol
MG_289
NCBI Protein Information
phosphonate ABC transporter substrate-binding protein
UniProt Protein Name
High affinity transport system protein p37
Protein Family
UniProt Gene Name
p37
UniProt Synonym Gene Names
MG289
UniProt Entry Name
P37_MYCGE
Uniprot Description
P37 is part of a high-affinity transport system.
Research Articles on p37
Similar Products
Product Notes
The p37 p37 (Catalog #AAA1360476) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-368aa; Full Length of Mature Protein. The amino acid sequence is listed below: CATKSDNTLI FNISLDHNAD TSIEKFFTVF SKKLSGKLNK KINVNFNIVD DSFTKINNIQ ANKADFAFVN SQAIASNNWF GYTPLIQTLT TAFKEDLELD YYEDGNLQKK AEKTNLLFLS PPYKEWDDIK QKWTGNRYDF LYEPSKLVSF YRSMILITGS ASEITAIKKA WNEKNWNQFM KFGIGHGQTN SASRFELPDL LFRKHFAKNY PGLQNAINSD PDKFAVVRGR EIGINKNIKI VFDDANSFSW TQNIKGSKRP FYTPIDPNDR LEILTYSDPL LYDIGIVSNN LSRIYQKAIG EIFIELAQSS EDLYGPSIGY NGYKMINDFE KEVVEIIEKT YGK. It is sometimes possible for the material contained within the vial of "High affinity transport system protein p37 (p37), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
