Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

P2Y purinoceptor 1 (P2RY1) Recombinant Protein | P2RY1 recombinant protein

Recombinant Chicken P2Y purinoceptor 1 (P2RY1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
P2Y purinoceptor 1 (P2RY1); Recombinant Chicken P2Y purinoceptor 1 (P2RY1); Recombinant P2Y purinoceptor 1 (P2RY1); P2Y purinoceptor 1; P2Y1; ATP receptor Purinergic receptor; P2RY1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-362
Sequence
MTEALISAALNGTQPELLAGGWAAGNATTKCSLTKTGFQFYYLPTVYILVFITGFLGNSVAIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIFHVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSGTGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDTSL
Sequence Length
362
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,194 Da
NCBI Official Full Name
P2Y purinoceptor 1
NCBI Official Synonym Full Names
purinergic receptor P2Y, G-protein coupled, 1
NCBI Official Symbol
P2RY1
NCBI Protein Information
P2Y purinoceptor 1; P2Y1; ATP receptor P2Y1; G protein-coupled receptor
UniProt Protein Name
P2Y purinoceptor 1
Protein Family
UniProt Gene Name
P2RY1
UniProt Synonym Gene Names
P2Y1
UniProt Entry Name
P2RY1_CHICK

Uniprot Description

Function: Receptor for extracellular adenine nucleotides such as ATP and ADP. Seems to mediate its action via a pertussis toxin insensitive G-protein, probably belonging to the G(q) family that activate a phosphatidylinositol-calcium second messenger system.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Tissue specificity: Brain, spinal cord, gastrointestinal tract, spleen and leg muscle. Is not detected in the heart, liver, stomach, lung and kidney.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Similar Products

Product Notes

The P2RY1 p2ry1 (Catalog #AAA961041) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-362. The amino acid sequence is listed below: MTEALISAAL NGTQPELLAG GWAAGNATTK CSLTKTGFQF YYLPTVYILV FITGFLGNSV AIWMFVFHMR PWSGISVYMF NLALADFLYV LTLPALIFYY FNKTDWIFGD VMCKLQRFIF HVNLYGSILF LTCISVHRYT GVVHPLKSLG RLKKKNAVYV SSLVWALVVA VIAPILFYSG TGVRRNKTIT CYDTTADEYL RSYFVYSMCT TVFMFCIPFI VILGCYGLIV KALIYKDLDN SPLRRKSIYL VIIVLTVFAV SYLPFHVMKT LNLRARLDFQ TPQMCAFNDK VYATYQVTRG LASLNSCVDP ILYFLAGDTF RRRLSRATRK SSRRSEPNVQ SKSEEMTLNI LTEYKQNGDT SL. It is sometimes possible for the material contained within the vial of "P2Y purinoceptor 1 (P2RY1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.