Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Non-structural polyprotein, partial Recombinant Protein | MAYVgp1 recombinant protein

Recombinant Mayaro virus Non-structural polyprotein, partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural polyprotein; partial; Recombinant Mayaro virus Non-structural polyprotein; Polyprotein nsP1234; P1234Cleaved into the following 7 chains:; 1. P123; 2. P123'; 3. mRNA-capping enzyme nsP1; EC=4. 2.1.1.-; EC=5. 2.7.7.-; Non-structural protein 1; Protease nsP2; EC=3.1.3.33; EC=3.4.22.-; EC=3.6.1.15; EC=3.; MAYVgp1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1005-1327; Peptidase C9 domain
Sequence
DVFQNKAKVCWAKCLVPVLETAGIKLSATDWSAIILAFKEDRAYSPEVALNEICTKIYGV DLDSGLFSAPRVSLHYTTNHWDNSPGGRMYGFSVEAANRLEQQHPFYRGRWASGQ VLVAERKTQPIDVTCNLIPFNRRLPHTLVTEYHPIKGERVEWLVNKIPGYHVLLVSEYNL ILPRRKVTWIAPPTVTGADLTYDLDLGLPPNAGRYDLVFVNMHTPYRLHHYQQCVDHA MKLQMLGGDALYLLKPGGSLLLSTYAYADRTSEAVVTALARRFSSFRAVTVRCVTSNT EVFLLFTNFDNGRRTVTLHQTNGKLSSIYAGT
Sequence Length
1327
Species
Mayaro virus (strain Brazil) (MAYV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
271,885 Da
NCBI Official Full Name
nonstructural polyprotein nsP1-nsP2-nsP3-nsP4
NCBI Official Symbol
MAYVgp1
NCBI Protein Information
nonstructural polyprotein nsP1-nsP2-nsP3-nsP4; nonstructural protein nsP1; nonstructural protein nsP2; nonstructural protein nsP3; nonstructural protein nsP4
UniProt Protein Name
Non-structural polyprotein
UniProt Gene Name
P1234
UniProt Synonym Gene Names
nsP2; nsP3; nsP3'; nsP4
UniProt Entry Name
POLN_MAYAB

Uniprot Description

P123 and P123' are short-lived polyproteins, accumulating during early stage of infection. P123 is directly translated from the genome, whereas P123' is a product of the cleavage of P1234. They localize the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, they start viral genome replication into antigenome. After these early events, P123 and P123' are cleaved sequentially into nsP1, nsP2 and nsP3/nsP3'. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex ().

Similar Products

Product Notes

The MAYVgp1 p1234 (Catalog #AAA1390631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1005-1327; Peptidase C9 domain. The amino acid sequence is listed below: DVFQNKAKVC WAKCLVPVLE TAGIKLSATD WSAIILAFKE DRAYSPEVAL NEICTKIYGV DLDSGLFSAP RVSLHYTTNH WDNSPGGRMY GFSVEAANRL EQQHPFYRGR WASGQ VLVAERKTQP IDVTCNLIPF NRRLPHTLVT EYHPIKGERV EWLVNKIPGY HVLLVSEYNL ILPRRKVTWI APPTVTGADL TYDLDLGLPP NAGRYDLVFV NMHTPYRLHH YQQCVDHA MKLQMLGGDA LYLLKPGGSL LLSTYAYADR TSEAVVTALA RRFSSFRAVT VRCVTSNT EVFLLFTNFD NGRRTVTLHQ TNGKLSSIYA GT . It is sometimes possible for the material contained within the vial of "Non-structural polyprotein, partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.