Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Hydrogen peroxide-inducible genes activator (oxyR) Recombinant Protein | oxyR recombinant protein

Recombinant Escherichia coli Hydrogen peroxide-inducible genes activator (oxyR)

Gene Names
oxyR; ECK3953; JW3933; momR; mor
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hydrogen peroxide-inducible genes activator (oxyR); Recombinant Escherichia coli Hydrogen peroxide-inducible genes activator (oxyR); oxyR recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-305, full length protein
Sequence
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANRECVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDKVLKQAV
Sequence Length
305
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,276 Da
NCBI Official Full Name
oxidative and nitrosative stress transcriptional regulator
NCBI Official Symbol
oxyR
NCBI Official Synonym Symbols
ECK3953; JW3933; momR; mor
NCBI Protein Information
oxidative and nitrosative stress transcriptional regulator
UniProt Protein Name
Hydrogen peroxide-inducible genes activator
UniProt Gene Name
oxyR
UniProt Synonym Gene Names
momR; mor

NCBI Description

This regulator belongs to the LysR family and participates in controlling several genes involved in the response to oxidative stress and the production of surface proteins that control colony morphology and autoaggregation ability. [More information is available at EcoCyc: EG10681].

Uniprot Description

Hydrogen peroxide sensor. Activates the expression of a regulon of hydrogen peroxide-inducible genes such as katG, gor, ahpC, ahpF, oxyS (a regulatory RNA), dps, fur and grxA. OxyR expression is negatively autoregulated by binding to a 43 bp region upstream of its own coding sequence. OxyR is inactivated by reduction of its essential disulfide bond by the product of GrxA, itself positively regulated by OxyR. Has also a positive regulatory effect on the production of surface proteins that control the colony morphology and auto-aggregation ability.

Research Articles on oxyR

Similar Products

Product Notes

The oxyR oxyr (Catalog #AAA1219831) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-305, full length protein. The amino acid sequence is listed below: MNIRDLEYLV ALAEHRHFRR AADSCHVSQP TLSGQIRKLE DELGVMLLER TSRKVLFTQA GMLLVDQART VLREVKVLKE MASQQGETMS GPLHIGLIPT VGPYLLPHII PMLHQTFPKL EMYLHEAQTH QLLAQLDSGK LDCVILALVK ESEAFIEVPL FDEPMLLAIY EDHPWANREC VPMADLAGEK LLMLEDGHCL RDQAMGFCFE AGADEDTHFR ATSLETLRNM VAAGSGITLL PALAVPPERK RDGVVYLPCI KPEPRRTIGL VYRPGSPLRS RYEQLAEAIR ARMDGHFDKV LKQAV. It is sometimes possible for the material contained within the vial of "Hydrogen peroxide-inducible genes activator (oxyR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual