Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Outer capsid glycoprotein VP7 Recombinant Protein

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer capsid glycoprotein VP7; Recombinant Rotavirus A Outer capsid glycoprotein VP7; Recombinant Outer capsid glycoprotein VP7; Outer capsid glycoprotein VP7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
51-326aa; full length protein
Sequence
QNYGINLPITGSMDTAYANSSQLDTFLTSTLCLYYPAEASTQIGDTEWKNTLSQLFLTKG WPTGSVYFKEYTDIASFSIDPQLYCDYNVVLMKYDSTLKLDMSELADLILNEWLCNPMDI TLYYYQQTDEANKWIAMGQSCTIKVCPLNTQTLGIGCTTTNTATFEEVAASEKLVITDVV DGVNHKLDVTTTTCTIRNCRKLGPRENVAIIQVGGSEVLDITADPTTAPQTERMMRINWK KWWQVFYTVVDYINQIVQVMSKRSRSLNSAAFYYRV
Sequence Length
326
Species
Rotavirus A (isolate Human/United States/WI61/1983 G9-P1A[8]-I1-R1-C1-M1-A1-N1-T1-E1-H1) (RV-A)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
37,039 Da
UniProt Protein Name
Outer capsid glycoprotein VP7
Protein Family
UniProt Entry Name
VP7_ROTWI

Uniprot Description

Function: Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved

By similarity.

Subunit structure: Homotrimer; in the presence of calcium

By similarity. Acquisition of the capsid outer layer requires a high calcium concentration inside the endoplasmic reticulum. Following cell entry, the low calcium concentration in the cytoplasm is probably responsible for the solubilization of the outer layer. Interacts with host integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3

By similarity.

Subcellular location: Virion

By similarity. Host endoplasmic reticulum lumen

Potential. Note: Immature double-layered particles assembled in the cytoplasm bud across the membrane of the endoplasmic reticulum, acquiring during this process a transient lipid membrane that is modified with the ER resident viral glycoproteins NSP4 and VP7; these enveloped particles also contain VP4. As the particles move towards the interior of the ER cisternae, the transient lipid membrane and the non-structural protein NSP4 are lost, while the virus surface proteins VP4 and VP7 rearrange to form the outermost virus protein layer, yielding mature infectious triple-layered particles

By similarity.

Post-translational modification: The N-terminus is blocked possibly by pyroglutamic acid

By similarity.N-glycosylated

By similarity.Intramolecular disulfide bonds

By similarity.

Miscellaneous: In group A rotaviruses, VP7 defines the G serotype.

Sequence similarities: Belongs to the rotavirus VP7 family.

Similar Products

Product Notes

The Outer capsid glycoprotein VP7 (Catalog #AAA1239696) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 51-326aa; full length protein. The amino acid sequence is listed below: QNYGINLPIT GSMDTAYANS SQLDTFLTST LCLYYPAEAS TQIGDTEWKN TLSQLFLTKG WPTGSVYFKE YTDIASFSID PQLYCDYNVV LMKYDSTLKL DMSELADLIL NEWLCNPMDI TLYYYQQTDE ANKWIAMGQS CTIKVCPLNT QTLGIGCTTT NTATFEEVAA SEKLVITDVV DGVNHKLDVT TTTCTIRNCR KLGPRENVAI IQVGGSEVLD ITADPTTAPQ TERMMRINWK KWWQVFYTVV DYINQIVQVM SKRSRSLNSA AFYYRV. It is sometimes possible for the material contained within the vial of "Outer capsid glycoprotein VP7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.