Oligosaccharyltransferase complex subunit OSTC (OSTC) Recombinant Protein | OSTC recombinant protein
Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Oligosaccharyltransferase complex subunit OSTC (OSTC); Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC); Recombinant Oligosaccharyltransferase complex subunit OSTC (OSTC); Oligosaccharyltransferase complex subunit OSTC; OSTC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-149
Sequence
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG
Sequence Length
149
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,815 Da
NCBI Official Full Name
oligosaccharyltransferase complex subunit OSTC
NCBI Official Symbol
OSTC
NCBI Protein Information
oligosaccharyltransferase complex subunit OSTC
UniProt Protein Name
Oligosaccharyltransferase complex subunit OSTC
Protein Family
UniProt Gene Name
OSTC
UniProt Entry Name
OSTC_CANFA
Uniprot Description
Subunit structure: Component of the oligosaccharyltransferase (OST) complex. OST seems to exist in different forms which contain at least RPN1, RPN2, OST48, DAD1, OSTC, KRTCAP2 and either STT3A or STT3B. OST can form stable complexes with the Sec61 complex or with both the Sec61 and TRAP complexes. Ref.3
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the OSTC family.
Similar Products
Product Notes
The OSTC ostc (Catalog #AAA718386) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-149. The amino acid sequence is listed below: METLYRVPFL VLECPNLKLK KPPWVHMPSA MTVYALVVVS YFLITGGIIY DVIVEPPSVG SMTDEHGHQR PVAFLAYRVN GQYIMEGLAS SFLFTMGGLG FIILDRSNAP NIPKLNRFLL LFIGFVCVLL SFFMARVFMR MKLPGYLMG. It is sometimes possible for the material contained within the vial of "Oligosaccharyltransferase complex subunit OSTC (OSTC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
