Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2) Recombinant Protein | ost2 recombinant protein
Recombinant Schizosaccharomyces pombe Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2); Recombinant Schizosaccharomyces pombe Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2); Recombinant Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2); Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 EC= 2.4.1.119; Oligosaccharyl transferase 16 kDa subunit Oligosac; ost2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-122
Sequence
MSSKSGLFLPLSSVITSYNENTNLSLKTIDAFLGFLVVVGGLQFGYALLVGTYPFNSFLSGFISCVGQFVITVGFRMALTQQELQSSSSKKKSPVVSPYKRAFLEFCFSSLVLHFFAVNFLG
Sequence Length
122
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,334 Da
NCBI Official Full Name
oligosaccharyltransferase epsilon subunit Ost2 (predicted)
NCBI Official Symbol
ost2
NCBI Protein Information
oligosaccharyltransferase epsilon subunit Ost2 (predicted)
UniProt Protein Name
Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2
UniProt Gene Name
ost2
UniProt Entry Name
OST2_SCHPO
Uniprot Description
Function: Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Catalytic activity: Dolichyl diphosphooligosaccharide + protein L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-glycosyl linkage to protein L-asparagine.
Pathway: Protein modification; protein glycosylation.
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the DAD/OST2 family.
Similar Products
Product Notes
The ost2 ost2 (Catalog #AAA1018995) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-122. The amino acid sequence is listed below: MSSKSGLFLP LSSVITSYNE NTNLSLKTID AFLGFLVVVG GLQFGYALLV GTYPFNSFLS GFISCVGQFV ITVGFRMALT QQELQSSSSK KKSPVVSPYK RAFLEFCFSS LVLHFFAVNF LG. It is sometimes possible for the material contained within the vial of "Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
