Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 Recombinant Protein | OST1 recombinant protein

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

Gene Names
OST1; NLT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1; OST1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-476aa; full length protein
Sequence
AQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN
Sequence Length
Full Length Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for OST1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for OST1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,072 Da
NCBI Official Full Name
dolichyl-diphosphooligosaccharide--protein glycotransferase subunit OST1
NCBI Official Symbol
OST1
NCBI Official Synonym Symbols
NLT1
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycotransferase subunit OST1
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
UniProt Gene Name
OST1
UniProt Synonym Gene Names
NLT1
UniProt Entry Name
OST1_YEAST

Uniprot Description

Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

Research Articles on OST1

Similar Products

Product Notes

The OST1 ost1 (Catalog #AAA7043262) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-476aa; full length protein. The amino acid sequence is listed below: AQYEPPATWE NVDYKRTIDV SNAYISETIE ITIKNIASEP ATEYFTAFES GIFSKVSFFS AYFTNEATFL NSQLLANSTT APGDDGESEI RYGIIQFPNA ISPQEEVSLV IKSFYNTVGI PYPEHVGMSE EQHLLWETNR LPLSAYDTKK ASFTLIGSSS FEEYHPPNDE SLLGKANGNS FEFGPWEDIP RFSSNETLAI VYSHNAPLNQ VVNLRRDIWL SHWASTIQFE EYYELTNKAA KLSKGFSRLE LMKQIQTQNM RQTHFVTVLD MLLPEGATDH YFTDLVGLVS TSHAERDHFF IRPRFPIFGG WNYNFTVGWT NKLSDFLHVS SGSDEKFVAS IPILNGPPDT VYDNVELSVF LPEGAEIFDI DSPVPFTNVS IETQKSYFDL NKGHVKLTFS YRNLISQVAN GQVLIKYDYP KSSFFKKPLS IACYIFTALM GVFVLKTLNM NVTN. It is sometimes possible for the material contained within the vial of "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.