Probable protein phosphatase 2C 9 Recombinant Protein | LOC4327465 recombinant protein
Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 9 (Os01g0846300, LOC_Os01g62760)
Gene Names
LOC4327465; OsPP2C09; OsJ_003961
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable protein phosphatase 2C 9; Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 9 (Os01g0846300; LOC_Os01g62760); LOC4327465 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-414aa; full length protein
Sequence
MAEICCEEAMSPPATATAAVAAAVSASAAAAVSSAIDRRRRRMEMRRIRIASDLELQAGE DGRPGKRQRLARTASGAPRPDEDSASERPSCGRTEEFPRYGVTAVCGRRREMEDAVSIRP DFLPASGKFHFYGVFDGHGCSHVATTCQDRMHEIVAEEHNKGASGEVAPWRDVMEKSFAR MDGEVGNRASTRSDDEPACPCEQQTPSRRDHAGSTAVVAVVSPTQVVVANAGDSRAVISR AGVPVALSVDHKPDRPDELERIEAAGGRVIYWDGARVLGVLAMSRAIGDGYLKPYVTSEP EVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACFHNNGPPAPAARPSGVPSSAEAA ETENGGAASVKGISKAESSDKACSDAAMLLTKLALARRSADNVSVVVVDLRRGL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LOC4327465 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,987 Da
NCBI Official Full Name
probable protein phosphatase 2C 9
NCBI Official Symbol
LOC4327465
NCBI Official Synonym Symbols
OsPP2C09; OsJ_003961
NCBI Protein Information
probable protein phosphatase 2C 9; LOC_Os01g62760; Os01g0846300; P0446B05.26-1; P0446B05.26-2; P0446B05.26-3; protein phosphatase 2c; putative protein phosphatase 2C
UniProt Protein Name
Probable protein phosphatase 2C 9
Protein Family
UniProt Gene Name
Os01g0846300
UniProt Synonym Gene Names
OsPP2C09
UniProt Entry Name
P2C09_ORYSJ
Similar Products
Product Notes
The LOC4327465 os01g0846300 (Catalog #AAA7039084) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-414aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LOC4327465 os01g0846300 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEICCEEAM SPPATATAAV AAAVSASAAA AVSSAIDRRR RRMEMRRIRI ASDLELQAGE DGRPGKRQRL ARTASGAPRP DEDSASERPS CGRTEEFPRY GVTAVCGRRR EMEDAVSIRP DFLPASGKFH FYGVFDGHGC SHVATTCQDR MHEIVAEEHN KGASGEVAPW RDVMEKSFAR MDGEVGNRAS TRSDDEPACP CEQQTPSRRD HAGSTAVVAV VSPTQVVVAN AGDSRAVISR AGVPVALSVD HKPDRPDELE RIEAAGGRVI YWDGARVLGV LAMSRAIGDG YLKPYVTSEP EVTVTERTDD DECLILASDG LWDVVTNEMA CEVVRACFHN NGPPAPAARP SGVPSSAEAA ETENGGAASV KGISKAESSD KACSDAAMLL TKLALARRSA DNVSVVVVDL RRGL. It is sometimes possible for the material contained within the vial of "Probable protein phosphatase 2C 9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
